pGGY001 vector (V005984)

LOCUS       V005984                 5269 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V005984
VERSION     V005984
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 5269)
  AUTHORS   Lampropoulos A, Sutikovic Z, Wenzl C, Maegele I, Lohmann JU, Forner
            J.
  TITLE     GreenGate - A Novel, Versatile, and Efficient Cloning System for
            Plant Transgenesis
  JOURNAL   PLoS ONE 8 (12), E83043 (2013)
   PUBMED   24376629
REFERENCE   2  (bases 1 to 5269)
  AUTHORS   Forner J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-SEP-2013) Centre for Organismal Studies,
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230,
            Heidelberg D-69221, Germany
REFERENCE   3  (bases 1 to 5269)
  AUTHORS   Forner J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2014) Centre for Organismal Studies,
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230,
            Heidelberg D-69221, Germany
REFERENCE   4  (bases 1 to 5269)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 5269)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2013"; volume: "8"; issue: "12"; pages: "E83043"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (28-SEP-2013) Centre for Organismal Studies,
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230,
            Heidelberg D-69221, Germany"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (13-JAN-2014) Centre for Organismal Studies,
            Ruprecht-Karls-Universitaet Heidelberg, Im Neuenheimer Feld 230,
            Heidelberg D-69221, Germany"
            SGRef: number: 4; type: "Journal Article"
            On Jan 13, 2014 this sequence version replaced KF718974.1.
FEATURES             Location/Qualifiers
     source          1..5269
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      26..515
                     /note="for replication in Agrobacterium tumefaciens; pSa
                     origin of replication"
     misc_feature    534..556
                     /label="LB T-DNA repeat"
                     /note="left border repeat from nopaline C58 T-DNA
                     (truncated)"
     misc_feature    complement(645..650)
                     /label="BsaI recognition site"
                     /note="BsaI recognition site"
     CDS             complement(1624..1986)
                     /gene="insC1"
                     /label="Transposase InsC for insertion element IS2"
                     /note="Transposase InsC for insertion element IS2 from
                     Shigella flexneri. Accession#: P59444"
     CDS             2117..2773
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     CDS             2795..3097
                     /label="ccdB"
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     CDS             3119..3370
                     /codon_start=1
                     /gene="lacZ alpha"
                     /product="beta-galactosidase alpha peptide"
                     /label="lacZ alpha"
                     /protein_id="AHE38477.1"
                     /translation="MLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ
                     LRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICSDAA"
     gene            3119..3370
                     /gene="lacZ alpha"
                     /label="lacZ alpha"
     misc_feature    3414..3419
                     /label="BsaI recognition site"
                     /note="BsaI recognition site"
     misc_feature    3469..3493
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     rep_origin      complement(3584..4172)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(4420..4950)
                     /label="GmR"
                     /note="gentamycin acetyltransferase"
     rep_origin      5241..5269
                     /label="pSa ori"
                     /note="origin of replication from bacterial plasmid pSa"