Basic Vector Information
- Vector Name:
- pGAD424A20ZF-
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7804 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- LEU2
pGAD424A20ZF- vector Map
pGAD424A20ZF- vector Sequence
LOCUS 40924_20940 7804 bp DNA circular SYN 18-DEC-2018
DEFINITION Yeast expression vector pGAD424A20ZF-, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7804)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7804)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 7804)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7804)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7804
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 5..406
/label=ADH1 promoter
/note="promoter for alcohol dehydrogenase 1"
CDS 452..472
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
CDS 488..829
/label=GAL4 activation domain
/note="activation domain of the GAL4 transcriptional
activator"
CDS 845..871
/label=HA
/note="HA (human influenza hemagglutinin) epitope tag"
CDS 887..1987
/codon_start=1
/note="unnamed protein product; hA20f"
/protein_id="SJL88290.1"
/translation="MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHR
YTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCL
MHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRN
WNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGS
NFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRG
RFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEIN
LVDDYFELVQHEYKKWQENSEQGRREG"
terminator 2386..2573
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
CDS complement(2694..3785)
/label=LEU2
/note="3-isopropylmalate dehydrogenase, required for
leucine biosynthesis"
promoter complement(3786..4190)
/label=LEU2 promoter
primer_bind complement(4232..4248)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4256..4272)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4280..4310)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4325..4346)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4634..5222)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5396..6253)
/label=AmpR
/note="beta-lactamase"
promoter complement(6254..6358)
/label=AmpR promoter
rep_origin 6640..7804
/label=2u ori
/note="yeast 2u plasmid origin of replication"
This page is informational only.