pART27 vector (Cat. No.: V007258)

pART2711612 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000105001100011500RB T-DNA repeatCAP binding sitelac promoterlac operatorM13 revSP6 promoterT7 promoterM13 fwdNOS promoterKanRNOS terminatorLB T-DNA repeatoriTIS1trfAoriaadAoriV
Basic Information

Note: pART27 is a plant expression vector.

Name:
pART27
Antibiotic Resistance:
Spectinomycin
Length:
11612 bp
Type:
Plant Expression Vectors
Replication origin:
oriV
Host:
Plants
Selection Marker:
nptII
Promoter:
NOS
Growth Strain(s):
stbl3
$ 198.5
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Benny A, Alex S, Soni KB, Anith KN, Kiran AG, Viji MM. Improved transformation of Agrobacterium assisted by silver nanoparticles. BioTechnologia (Pozn). 2022 Sep 29;103(3):311-317.

pART27 vector (Cat. No.: V007258) Sequence

LOCUS       Exported               11612 bp DNA     circular SYN 02-SEP-2024
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11612)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 11612)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 11612)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11612
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(480..504)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     protein_bind    759..780
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        795..825
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    833..849
                     /label=lac repressor encoded by lacI binding site
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     857..873
                     /label=M13 rev
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        891..909
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"
     promoter        complement(1029..1047)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1054..1070)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1228..1411
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             1412..2230
                     /label=KanR
                     /note="fusion between an N-terminal peptide of nopaline
                     synthase and Tn5 aminoglycoside phosphotransferase"
     terminator      2858..3110
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    complement(3173..3197)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     oriT            3752..3861
                     /label=oriT
                     /note="incP origin of transfer"
     mobile_element  3921..4688
                     /label=IS1
                     /note="prokaryotic transposable element"
     CDS             4688..5038
                     /label=traJ
                     /note="oriT-recognizing protein"
     CDS             5313..6458
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     rep_origin      complement(7821..8409)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             9506..10294
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy,
                     1985)"
                     /label=aadA
                     /note="SmR"
                     /note="confers resistance to spectinomycin and
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      complement(10899..11612)
                     /direction=LEFT
                     /label=oriV
                     /note="incP origin of replication"