Basic Vector Information
- Vector Name:
- Kif5A-GFP-CIBN
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6796 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- CMV forward
Kif5A-GFP-CIBN vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Kif5A-GFP-CIBN vector Sequence
LOCUS 40924_1499 6796 bp DNA circular SYN 13-MAY-2021 DEFINITION Expresses fusion of kinesin heavy chain 5A (1-572) with GFP and CIB1 (1-170). ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6796) AUTHORS Duan L, Che D, Zhang K, Ong Q, Guo S, Cui B TITLE Optogenetic control of molecular motors and organelle distributions in cells. JOURNAL Chem Biol. 2015 May 21;22(5):671-82. doi: 10.1016/j.chembiol.2015.04.014. Epub 2015 May 9. PUBMED 25963241 REFERENCE 2 (bases 1 to 6796) TITLE Direct Submission REFERENCE 3 (bases 1 to 6796) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1016/j.chembiol.2015.04.014"; journalName: "Chem Biol"; date: "2015-05-21- 21"; volume: "22"; issue: "5"; pages: "671-82" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..6796 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" regulatory 606..615 /label=Kozak sequence /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 2334..3050 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" polyA_signal 3584..3705 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3712..4167) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 4194..4298 /label=AmpR promoter promoter 4300..4657 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4692..5483 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" primer_bind complement(5674..5693) /label=TK-pA-R /note="Thymidine kinase polyA, reverse primer" polyA_signal 5718..5765 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 6094..6682 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.