pHR-tdPP7-3xmCherry vector (V007496)

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V007496 pHR-tdPP7-3xmCherry In stock, 1 week for quality controls

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pHR-tdPP7-3xmCherry
Antibiotic Resistance:
Ampicillin
Length:
11752 bp
Type:
Mammalian Expression, Lentiviral
Replication origin:
ori
Copy Number:
High Copy
Promoter:
SFFV

pHR-tdPP7-3xmCherry vector Map

pHR-tdPP7-3xmCherry11752 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000105001100011500pBRrevBampGEX 3'pBRforEcoAmpR promoterAmpRoriL4440SV40 promotersmall t intronSV40 NLSSV40 poly(A) signal3' LTRHIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSSFFV promoterCapsid proteinmCherryGB1mCherryGB1mCherry3' LTR (Delta-U3)

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pHR-tdPP7-3xmCherry vector Sequence

LOCUS       V007496                11752 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V007496
VERSION     V007496
KEYWORDS    pHR-tdPP7-3xmCherry
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 11752)
  AUTHORS   Yan X, Hoek TA, Vale RD, Tanenbaum ME
  TITLE     Dynamics of Translation of Single mRNA Molecules In Vivo.
  JOURNAL   Cell. 2016 May 5;165(4):976-89. doi: 10.1016/j.cell.2016.04.034.
   PUBMED   27153498
REFERENCE   2  (bases 1 to 11752)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 11752)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; doi:
            "10.1016/j.cell.2016.04"; journalName: "Cell"; date: "2016-05-5- 5";
            volume: "165"; issue: "4"; pages: "976-89"
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11752
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     complement(302..321)
                     /label="pBRrevBam"
                     /note="pBR322 vectors, tet region, downstream of BamHI,
                     reverse primer"
     primer_bind     655..677
                     /label="pGEX 3'"
                     /note="pGEX vectors, reverse primer"
     primer_bind     complement(715..733)
                     /label="pBRforEco"
                     /note="pBR322 vectors, upsteam of EcoRI site, forward
                     primer"
     promoter        801..905
                     /label="AmpR promoter"
     CDS             906..1763
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      1937..2525
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     primer_bind     2679..2696
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     promoter        2771..3100
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     intron          4234..4299
                     /label="small t intron"
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             4429..4449
                     /label="SV40 NLS"
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    4874..5008
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     LTR             5177..5810
                     /label="3' LTR"
                     /note="3' long terminal repeat (LTR) from HIV-1"
     misc_feature    5857..5982
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    6474..6707
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             6892..6936
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             7085..7126
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    7221..7338
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        7491..7898
                     /label="SFFV promoter"
                     /note="spleen focus-forming virus long terminal repeat
                     (LTR) promoter"
     CDS             7945..8328
                     /note="Capsid protein from Pseudomonas phage PP7.
                     Accession#: P03630"
                     /label="Capsid protein"
     CDS             8797..9501
                     /label="mCherry"
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     CDS             9547..9708
                     /codon_start=1
                     /product="B1 domain of Streptococcal protein G   "
                     /label="GB1"
                     /note="effective as a solubilizing fusion partner (Cheng
                     and Patel, 2004)"
                     /translation="YKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD
                     ATKTFTVTE"
     CDS             9733..10437
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
                     /label="mCherry"
                     /note="mammalian codon-optimized"
                     /translation="VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGT
                     QTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFE
                     DGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKG
                     EIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAE
                     GRHSTGGMDELYK"
     CDS             10483..10644
                     /codon_start=1
                     /product="B1 domain of Streptococcal protein G   "
                     /label="GB1"
                     /note="effective as a solubilizing fusion partner (Cheng
                     and Patel, 2004)"
                     /translation="YKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD
                     ATKTFTVTE"
     CDS             10702..11406
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
                     /label="mCherry"
                     /note="mammalian codon-optimized"
                     /translation="VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGT
                     QTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFE
                     DGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKG
                     EIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAE
                     GRHSTGGMDELYK"
     LTR             11488..11721
                     /label="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     HIV-1"