MOS vector (V006609)

Basic Vector Information

      • Vector Name:
      • MOS
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 9879 bp
      • Type:
      • Mammalian Expression
      • Promoter:
      • SFFV
      • Cloning Method:
      • Restriction Enzyme
      • 5' Primer:
      • 5-AGGCATGGAAAAATACCAAA, or 5-TAACCAATCAGCCTGCTTCT

MOS vector Vector Map

MOS9879 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600SFFV promoterE2AMycFLAGWPRE-RFactor Xa siteSV40 poly(A) signalpGEX 3'oriPpBRforEcoAmpR promoterAmpRori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

MOS vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                9879 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  A modified episomal (EBNA1/oriP) vector expressing human OCT4 and 
            SOX2 genes.
ACCESSION   .
VERSION     .
KEYWORDS    MOS
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9879)
  AUTHORS   Chou BK, Gu H, Gao Y, Dowey SN, Wang Y, Shi J, Li Y, Ye Z, Cheng T, 
            Cheng L
  TITLE     A Facile Method to Establish Human Induced Pluripotent Stem Cells 
            From Adult Blood Cells Under Feeder-Free and Xeno-Free Culture 
            Conditions: A Clinically Compliant Approach.
  JOURNAL   Stem Cells Transl Med. 2015 Mar 5. pii: sctm.2014-0214.
  PUBMED    25742692
REFERENCE   2  (bases 1 to 9879)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Stem Cells 
            Transl Med. 2015 Mar 5. pii: sctm.2014-0214."
FEATURES             Location/Qualifiers
     source          1..9879
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        120..527
                     /label=SFFV promoter
                     /note="spleen focus-forming virus long terminal repeat 
                     (LTR) promoter"
     CDS             1621..1680
                     /codon_start=1
                     /product="2A peptide from equine rhinitis A virus 
                     polyprotein"
                     /label=E2A
                     /note="Eukaryotic ribosomes fail to insert a peptide bond 
                     between the Gly and Pro residues, yielding separate 
                     polypeptides."
                     /translation="QCTNYALLKLAGDVESNPGP"
     CDS             2650..2679
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             2698..2721
                     /codon_start=1
                     /product="FLAG(R) epitope tag, followed by an enterokinase 
                     cleavage site"
                     /label=FLAG
                     /translation="DYKDDDDK"
     primer_bind     complement(2791..2811)
                     /label=WPRE-R
                     /note="WPRE, reverse primer"
     CDS             complement(3209..3220)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     polyA_signal    3317..3451
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(3341..3360)
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     primer_bind     3395..3414
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     complement(3594..3616)
                     /label=pGEX 3'
                     /note="pGEX vectors, reverse primer"
     rep_origin      4179..5968
                     /label=oriP
                     /note="Epstein-Barr virus oriP replication origin (Yates et
                     al., 2000)"
     primer_bind     complement(8006..8024)
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward 
                     primer"
     promoter        8092..8196
                     /gene="bla"
                     /label=AmpR promoter
     CDS             8197..9057
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     primer_bind     complement(8415..8434)
                     /label=Amp-R
                     /note="Ampicillin resistance gene, reverse primer"
     rep_origin      9228..9816
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     9717..9736
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"

This page is informational only.