pSGKP-km vector (Cat. No.: V006674)
Note: The pSGKP-km is a 4,729 bp plasmid vector designed for CRISPR-Cas9-mediated genome editing in Klebsiella pneumoniae. It functions as an sgRNA expression plasmid within a two-plasmid system and features a high copy number origin of replication. Selection is achieved via a kanamycin resistance gene (50 µg/mL). The vector utilizes Gibson Assembly cloning and is specifically optimized for use in bacterial hosts like strain Top10 or DH5alpha at 37°C, enabling precise genetic manipulations.
- Name:
- pSGKP-km
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4729 bp
- Type:
- Bacterial Expression, CRISPR, Synthetic Biology
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- J23119(SpeI)
- Cloning Method:
- Gibson Cloning
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Wang Y, Wang S, Chen W, Song L, Zhang Y, Shen Z, Yu F, Li M, Ji Q. CRISPR-Cas9 and CRISPR-Assisted Cytidine Deaminase Enable Precise and Efficient Genome Editing in Klebsiella pneumoniae. Appl Environ Microbiol. 2018 Nov 15;84(23):e01834-18. doi: 10.1128/AEM.01834-18. PMID: 30217854; PMCID: PMC6238054.
pSGKP-km vector (Cat. No.: V006674) Sequence
LOCUS 40924_39942 4729 bp DNA circular SYN 13-MAY-2021
DEFINITION A sgRNA expression plasmid for genome editing in Klebsiella
Pneumoniae.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4729)
AUTHORS Wang Y, Wang S, Chen W, Song L, Zhang Y, Shen Z, Yu F, Li M, Ji Q
TITLE Precise and efficient genome editing in Klebsiella pneumoniae using
CRISPR-Cas9 and CRISPR-assisted cytidine deaminase.
JOURNAL Appl Environ Microbiol. 2018 Sep 14. pii: AEM.01834-18. doi:
10.1128/AEM.01834-18.
PUBMED 30217854
REFERENCE 2 (bases 1 to 4729)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4729)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl
Environ Microbiol. 2018 Sep 14. pii: AEM.01834-18. doi:
10.1128/AEM.01834-18."
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4729
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 97..131
/label=J23119(SpeI) promoter
/note="bacterial promoter (Registry of Standard Biological
Parts BBa_J23119) modified to end with an SpeI site"
misc_RNA 149..224
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
primer_bind complement(257..273)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(332..348)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(356..372)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(380..410)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(425..446)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
primer_bind complement(563..580)
/label=L4440
/note="L4440 vector, forward primer"
rep_origin complement(734..1322)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1496..2308)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
promoter complement(2309..2413)
/label=AmpR promoter
primer_bind 2481..2499
/label=pBRforEco
/note="pBR322 vectors, upsteam of EcoRI site, forward
primer"
primer_bind complement(2537..2559)
/label=pGEX 3'
/note="pGEX vectors, reverse primer"
primer_bind 2887..2903
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
primer_bind 2941..2957
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(3022..4440)
/codon_start=1
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
/translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH
ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH
IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW
SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG
KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA
YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE
IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK
MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV
VKDSILEQGQLTVNK"