MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP vector (Cat. No.: V006838)
Note: The plasmid is a retroviral mammalian expression vector, which is used to express the human p210BCR-ABL protein in mammalian cells.
- Name:
- MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 13502 bp
- Type:
- Mammalian Expression, Retroviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- MSCV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- pLXSN5'
- 3' Primer:
- pCDH-rev
- Growth Strain(s):
- Stbl3
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP vector (Cat. No.: V006838) Sequence
LOCUS Exported 13502 bp DNA circular SYN 05-JUN-2025
DEFINITION Exported.
ACCESSION V006838
VERSION .
KEYWORDS MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 13502)
TITLE Roussel lab plasmids
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 13502)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 13502)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 13502)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..13502
/mol_type="other DNA"
/organism="synthetic DNA construct"
LTR 1..517
/label=5' LTR
/note="5' long terminal repeat from murine embryonic stem
cell virus"
misc_feature 581..922
/label=MESV Psi
/note="packaging signal of murine embryonic stem cell
virus"
CDS 989..1405
/label=gag (truncated)
/note="truncated Moloney murine leukemia virus (MMLV) gag
gene lacking the start codon"
CDS 1538..4318
/codon_start=1
/label=p210 BCR
/translation="MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRL
EQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADG
ADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRK
GHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSS
VGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQS
IYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTS
SEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVV
SEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDD
SPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHL
EALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQR
VGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTT
KNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITP
RRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDC
KWYIPLTDLSFQMVDELEAVPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKATE
RLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRENIREQQKKCFRS
FSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSS"
CDS 4319..7630
/gene="ABL1"
/label=Tyrosine-protein kinase ABL1
/note="Tyrosine-protein kinase ABL1 from Homo sapiens.
Accession#: P00519"
misc_feature 8452..9013
/label=IRES
/note="internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
CDS 9016..9732
/label=EGFP
/note="enhanced GFP"
LTR 9897..10411
/label=3' LTR
/note="3' long terminal repeat from murine embryonic stem
cell virus"
protein_bind 10573..10589
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(10597..10627)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(10642..10663)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
primer_bind complement(10780..10797)
/label=L4440
/note="L4440 vector, forward primer"
rep_origin complement(10951..11539)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(11713..12570)
/label=AmpR
/note="beta-lactamase"
promoter complement(12571..12675)
/label=AmpR promoter
primer_bind 12743..12761
/label=pBRforEco
/note="pBR322 vectors, upsteam of EcoRI site, forward
primer"
primer_bind complement(12799..12821)
/label=pGEX 3'
/note="pGEX vectors, reverse primer"
primer_bind 12921..12940
/label=pRS-marker
/note="pRS vectors, use to sequence yeast selectable
marker"
primer_bind 13134..13156
/label=M13/pUC Forward
/note="In lacZ gene"
primer_bind 13284..13303
/label=pBRrevBam
/note="pBR322 vectors, tet region, downstream of BamHI,
reverse primer"