Basic Vector Information
- Vector Name:
- pNN_v2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2746 bp
- Type:
- Bacterial Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
pNN_v2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNN_v2 vector Sequence
LOCUS 40924_33412 2746 bp DNA circular SYN 13-MAY-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2746) AUTHORS Sanjana NE, Cong L, Zhou Y, Cunniff MM, Feng G, Zhang F TITLE A transcription activator-like effector toolbox for genome engineering. JOURNAL Nat Protoc. 2012 Jan 5;7(1):171-92. doi: 10.1038/nprot.2011.431. PUBMED 22222791 REFERENCE 2 (bases 1 to 2746) TITLE Direct Submission REFERENCE 3 (bases 1 to 2746) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1038/nprot.2011"; journalName: "Nat Protoc"; date: "2012-01-5- 5"; volume: "7"; issue: "1"; pages: "171-92" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..2746 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(3..809) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(810..901) /gene="bla" /label=AmpR promoter primer_bind 968..987 /label=pENTR-R /note="pENTR vectors, reverse primer" primer_bind complement(1748..1764) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" primer_bind complement(1863..1880) /label=L4440 /note="L4440 vector, forward primer" rep_origin complement(2034..2622) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.