Basic Vector Information
Lamp1-RFP vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
Lamp1-RFP vector Sequence
LOCUS 40924_1594 5906 bp DNA circular SYN 21-DEC-2021 DEFINITION Mammalian expression of Lamp1 fused to RFP. Used for localization to the lysosome.. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5906) AUTHORS Sherer NM, Lehmann MJ, Jimenez-Soto LF, Ingmundson A, Horner SM, Cicchetti G, Allen PG, Pypaert M, Cunningham JM, Mothes W TITLE Visualization of retroviral replication in living cells reveals budding into multivesicular bodies. JOURNAL Traffic 2003 Nov;4(11):785-801. PUBMED 14617360 REFERENCE 2 (bases 1 to 5906) TITLE Direct Submission REFERENCE 3 (bases 1 to 5906) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Traffic"; date: "2003-11"; volume: "4(11)"; pages: "785-801" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..5906 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(193..297) /label=AmpR promoter rep_origin 324..779 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" polyA_signal complement(786..907) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(1042..1716) /codon_start=1 /label=mRFP1 /note="monomeric derivative of DsRed (Campbell et al., 2002)" /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS TGA" CDS complement(1738..2958) /codon_start=1 /label=LAMP1 /note="rat lysosome-associated membrane glycoprotein 1" /translation="MAAPGARRPLLLLLLAGLAHSAPALFEVKDNNGTACIMASFSASF LTTYEAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTT RYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTI VLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGT CLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFG MNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKAL ALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKR SHAGYQTI" promoter complement(3033..3236) /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" enhancer complement(3237..3540) /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" rep_origin complement(3715..4303) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(4632..4679) /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(4914..5705) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" promoter complement(join(5740..5906,1..191)) /label=SV40 promoter /note="SV40 enhancer and early promoter"
This page is informational only.