Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V007110 | cytoplasmic EKAR (Cerulean-Venus) | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- cytoplasmic EKAR (Cerulean-Venus)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6758 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- SV40
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- CMV Forward
cytoplasmic EKAR (Cerulean-Venus) vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
cytoplasmic EKAR (Cerulean-Venus) vector Sequence
LOCUS 40924_555 6758 bp DNA circular SYN 13-MAY-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6758) AUTHORS Harvey CD, Ehrhardt AG, Cellurale C, Zhong H, Yasuda R, Davis RJ, Svoboda K. TITLE A genetically encoded fluorescent sensor of ERK activity JOURNAL PNAS 2008 Dec 9;105(49):19264-9 PUBMED 19033456 REFERENCE 2 (bases 1 to 6758) TITLE Direct Submission REFERENCE 3 (bases 1 to 6758) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PNAS"; date: "2008-12-9"; volume: "105(49)"; pages: "19264-" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..6758 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 14..393 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 394..597 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 827..845 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind 858..877 /label=pMT2-F /note="Synthetic intron, forward primer" CDS 939..1655 /codon_start=1 /label=mCerulean /note="enhanced monomeric variant of CFP (Rizzo et al., 2004)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIK ANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 2220..2936 /codon_start=1 /product="Venus YFP with monomerizing A206K mutation (Nagai et al., 2002; Kremers et al., 2006)" /label=mVenus /note="mammalian codon-optimized" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" regulatory 3007..3016 /label=Kozak sequence /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" polyA_signal 3020..3154 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter 3223..3580 /label=SV40 promoter /note="SV40 enhancer and early promoter" primer_bind complement(3600..3616) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 3829..4284 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind complement(4301..4320) /label=pRS-marker /note="pRS vectors, use to sequence yeast selectable marker" primer_bind 4455..4477 /label=pGEX 3' /note="pGEX vectors, reverse primer" primer_bind complement(4530..4548) /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer" promoter 4616..4720 /label=AmpR promoter CDS 4721..5578 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRDDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 5752..6340 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 6494..6511 /label=L4440 /note="L4440 vector, forward primer" protein_bind 6628..6649 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6664..6694 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6702..6718 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6726..6742 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"