pCRB1 vector (V008189)

LOCUS       40924_13325        4051 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector pCRB1 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4051)
  AUTHORS   Tsuchida Y, Kimura S, Suzuki N, Inui M, Yukawa H.
  TITLE     Characterization of a 24-kb plasmid pCGR2 newly isolated from 
            Corynebacterium glutamicum
  JOURNAL   Appl. Microbiol. Biotechnol. 87 (5), 1855-1866 (2010)
  PUBMED    20552356
REFERENCE   2  (bases 1 to 4051)
  AUTHORS   Inui M, Suzuki N, Nakata K, Yukawa H.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2008) Contact:Masayuki Inui Research Institute of 
            Innovative Technology for the Earth, Molecular Microbiology and 
            Biotechnology Group; 9-2 kizugawadai, kizugawa, kyoto 619-0292, 
            Japan URL :http://www.rite.or.jp/
REFERENCE   3  (bases 1 to 4051)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4051)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Microbiol. Biotechnol."; date: "2010"; volume: "87"; issue: "5"; 
            pages: "1855-1866"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (03-JUL-2008) Contact:Masayuki Inui Research Institute of Innovative
            Technology for the Earth, Molecular Microbiology and Biotechnology 
            Group; 9-2 kizugawadai, kizugawa, kyoto 619-0292, Japan URL 
            :http://www.rite.or.jp/"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4051
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        101..203
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             204..860
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     protein_bind    1071..1092
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1107..1137
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    1145..1161
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     1169..1185
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    1198..1254
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(1255..1271)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      complement(1597..2185)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    2237..4051
                     /note="derived from Brevibacterium lactofermentum cryptric 
                     plasmid pBL1"
     CDS             2760..3965
                     /codon_start=1
                     /gene="rep"
                     /product="replicase"
                     /label=rep
                     /protein_id="BAG54977.1"
                     /translation="MYKITNSKALAGCHRWRRDEAVAVSWSSNGASQFEGLQNSHSRWG
                     SPLAELEVMGERRIELAIATKNHLAAGGALMMFVGTVRHNRSQSFAQVEAGIKTAYSSM
                     VKTSQWKKERARYGVEHTYSDYEVTDSWANGWHLHRNMLLFLDRPLSDDELKAFEDSMF
                     SRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDAAKMATYLAKGMSQELTGSATKTASKG
                     SYTPFQMLDMLADQSDAGEDMDAVLVARWREYEVGSKNLRSSWSRGAKRALGIDYIDAD
                     VRREMEEELYKLAGLEAPERVESTRVAVALVKPDDWKLIQSDFAVRQYVLDCVDKAKDV
                     AAAQRVANEVLASLGVDSTPCMIVMDDVDLDAVLPTHGDATKRDLNAAVFAGNEQTILR
                     TH"
     gene            2760..3965
                     /gene="rep"
                     /label=rep