Basic Vector Information
- Vector Name:
- pCM160
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7974 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM160 vector Map
pCM160 vector Sequence
LOCUS 40924_11331 7974 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pCM160, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7974)
AUTHORS Marx CJ, Lidstrom ME.
TITLE Development of improved versatile broad-host-range vectors for use
in methylotrophs and other Gram-negative bacteria
JOURNAL Microbiology 147 (Pt 8), 2065-2075 (2001)
PUBMED 11495985
REFERENCE 2 (bases 1 to 7974)
AUTHORS Marx CJ, Lidstrom ME.
TITLE Direct Submission
JOURNAL Submitted (12-DEC-2000) Microbiology, University of Washington, Box
357242, Seattle, WA 98195, USA
REFERENCE 3 (bases 1 to 7974)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7974)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Microbiology 147 (Pt 8), 2065-2075 (2001)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-DEC-2000) Microbiology, University of Washington, Box 357242,
Seattle, WA 98195, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7974
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 3..712
/label=oriV
/note="incP origin of replication"
rep_origin 1105..1693
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 1981..2002
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2017..2047
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2055..2071
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2079..2095
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
regulatory 2118..2435
/note="PmxaF; Methylobacterium extorquens mxa operon
promoter"
/regulatory_class="promoter"
primer_bind 2446..2462
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
misc_feature complement(2475..2531)
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(2532..2548)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(2993..3634)
/label=TetR
/note="tetracycline resistance regulatory protein"
CDS complement(4415..5227)
/label=KanR
/note="aminoglycoside phosphotransferase"
CDS complement(5902..7047)
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
CDS complement(7319..7690)
/codon_start=1
/gene="traJ"
/product="oriT-recognizing protein"
/label=traJ
/translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV
GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
KQDELGKVMMGVVRPRAEP"
CDS complement(7574..7690)
/codon_start=1
/gene="traJ'"
/product="TraJ'"
/label=traJ'
/note="truncated oriT-recognizing protein"
/protein_id="AAK73413.1"
/translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL"
gene complement(7574..7690)
/gene="traJ'"
/label=traJ'
oriT complement(7723..7832)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
This page is informational only.