pCK906 vector (V008480)

LOCUS       V008480                 8379 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008480
VERSION     V008480
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8379)
  AUTHORS   Kraft C.
  TITLE     A toolbox for the analysis of weak and low abundant molecule
            interactions in vivo by M-Track in budding yeast
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8379)
  AUTHORS   Brezovich A, Schuschnig M, Ammerer G, Kraft C.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2014) Department of Biochemistry and Cell Biology,
            MFPL, University of Vienna, Dr. Bohr Gasse 9, Vienna 1030, Austria
REFERENCE   3  (bases 1 to 8379)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8379)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (28-AUG-2014) Department of Biochemistry and Cell Biology, MFPL,
            University of Vienna, Dr. Bohr Gasse 9, Vienna 1030, Austria"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8379
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    155..176
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        191..221
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    229..245
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     253..269
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        290..308
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     regulatory      345..993
                     /gene="ATG18"
                     /regulatory_class="promoter"
     CDS             994..2493
                     /gene="ATG18"
                     /label="Autophagy-related protein 18"
                     /note="Autophagy-related protein 18 from Saccharomyces
                     cerevisiae (strain ATCC 204508 / S288c). Accession#:
                     P43601"
     CDS             2554..2574
                     /label="TEV site"
                     /note="tobacco etch virus (TEV) protease recognition and
                     cleavage site"
     CDS             2605..2778
                     /label="ProtA"
                     /note="IgG-binding unit of Staphylococcus aureus protein A"
     CDS             2782..2952
                     /codon_start=1
                     /product="IgG-binding unit of Staphylococcus aureus protein
                     A"
                     /label="ProtA"
                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNALIQSLKDDPSQSANLLA
                     EAKKLNDAQAPK"
     misc_feature    3019..3312
                     /gene="ATG18"
                     /label="4x Histone3"
                     /note="4x Histone3"
     CDS             3337..3426
                     /label="3xHA"
                     /note="three tandem HA epitope tags"
     CDS             3445..3462
                     /label="6xHis"
                     /note="6xHis affinity tag"
     CDS             3466..3537
                     /label="3xFLAG"
                     /note="three tandem FLAG(R) epitope tags"
     CDS             3538..3561
                     /label="FLAG"
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     terminator      3584..3831
                     /label="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     promoter        complement(3850..3868)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3878..3894)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      4035..4490
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     CDS             complement(4753..5409)
                     /label="HIS3"
                     /note="imidazoleglycerol-phosphate dehydratase, required
                     for histidine biosynthesis"
     promoter        complement(5410..5596)
                     /label="HIS3 promoter"
     misc_feature    complement(5982..6485)
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     promoter        6522..6626
                     /label="AmpR promoter"
     CDS             6627..7484
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      7658..8246
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"