Basic Vector Information
- Vector Name:
- pCK226
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7241 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kelly CL, Harris AW, Steel H, Hancock EJ, Heap JT, Papachristodoulou A.
- Promoter:
- Pm
pCK226 vector Map
pCK226 vector Sequence
LOCUS 40924_10781 7241 bp DNA circular SYN 17-DEC-2018
DEFINITION Expression vector pCK226, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7241)
AUTHORS Kelly CL, Harris AW, Steel H, Hancock EJ, Heap JT, Papachristodoulou
A.
TITLE Synthetic negative feedback circuits using engineered small RNAs
JOURNAL Nucleic Acids Res. (2018) In press
PUBMED 30212900
REFERENCE 2 (bases 1 to 7241)
AUTHORS Kelly CL, Harris AWK., Steel H, Hancock EJ, Heap JT,
Papachristodoulou A.
TITLE Direct Submission
JOURNAL Submitted (03-SEP-2018) School of Natural and Environmental
Sciences, Newcastle University, Agriculture Building, King's Road,
Newcastle NE1 7RU, United Kingdom
REFERENCE 3 (bases 1 to 7241)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7241)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(03-SEP-2018) School of Natural and Environmental Sciences,
Newcastle University, Agriculture Building, King's Road, Newcastle
NE1 7RU, United Kingdom"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..7241
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 17..605
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
primer_bind 875..891
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
regulatory complement(908..1021)
/label=rpn txn term terminator
/note="rpn txn term terminator"
/regulatory_class="terminator"
regulatory complement(1028..1328)
/label=bla txn term terminator
/note="bla txn term terminator"
/regulatory_class="terminator"
protein_bind 1346..1364
/label=tet operator
/note="bacterial operator O2 for the tetR and tetA genes"
misc_binding 1371..1389
/label=tetracycline repressor TetR binding site
/bound_moiety="tetracycline repressor TetR"
/note="operator 2"
protein_bind 1371..1389
/gene="tetO"
/label=tet operator
/bound_moiety="tetracycline repressor TetR"
/note="bacterial operator O2 for the tetR and tetA genes"
regulatory 1401..1428
/label=Synthetic RBS
/note="Synthetic RBS"
/regulatory_class="ribosome_binding_site"
CDS 1429..2046
/codon_start=1
/gene="tetR from transposon Tn10"
/product="tetracycline repressor TetR"
/label=TetR
/note="TetR binds to the tetracycline operator tetO to
inhibit transcription. This inhibition can be relieved by
adding tetracycline or doxycycline."
/translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV
KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR
PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT
DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESG"
CDS 2050..2760
/label=superfolder GFP
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Pedelacq et al., 2006)"
CDS 2779..2796
/label=6xHis
/note="6xHis affinity tag"
regulatory 2829..3003
/label=rrnB1 B2 T1 term terminator
/note="rrnB1 B2 T1 term terminator"
/regulatory_class="terminator"
terminator complement(3046..3073)
/label=T7Te terminator
/note="phage T7 early transcription terminator"
terminator complement(3089..3160)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature complement(3175..3253)
/label=micC Hfq binding scaffold
/note="micC Hfq binding scaffold"
misc_feature complement(3254..3277)
/label=sRNA tetR from SD
/note="sRNA tetR from SD"
promoter complement(3278..3358)
/label=Pm promoter
/note="The bacterial Pm promoter is activated by XylS in
the presence of benzoate or m-toluate (Marques et al.,
1999)."
CDS 4258..5220
/label=XylS
/note="XylS regulator encoded by the Pseudomonas putida TOL
plasmid pWWO"
promoter 5274..5365
/gene="bla"
/label=AmpR promoter
regulatory 5296..5324
/label=ampR promoter
/note="ampR promoter"
/regulatory_class="promoter"
CDS 5366..6223
/label=AmpR
/note="beta-lactamase"
regulatory 6238..6271
/label=Ecoli rhaS RBS
/note="Ecoli rhaS RBS"
/regulatory_class="ribosome_binding_site"
CDS 6272..7105
/label=rhaS
/note="positive regulator of the rhaB promoter"
This page is informational only.