CHOP promoter (-649/+136) pmCherry-1 vector (V012177)

Basic Vector Information

      • Vector Name:
      • CHOP promoter (-649/+136) pmCherry-1
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 4880 bp
      • Type:
      • Mammalian Expression
      • Selection Marker:
      • Neomycin (select with G418)
      • Copy Number:
      • High Copy
      • Cloning Method:
      • Restriction Enzyme
      • 5' Primer:
      • custom: GGCCTTTTGCTCACATGTTC

CHOP promoter (-649/+136) pmCherry-1 vector Vector Map

CHOP promoter (-649/+136) pmCherry-14880 bp6001200180024003000360042004800Kozak sequenceSV40 poly(A) signalf1 oriAmpR promoterSV40 promoterNeoR/KanRTK-pA-RHSV TK poly(A) signalori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

CHOP promoter (-649/+136) pmCherry-1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4880 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    CHOP promoter (-649/+136) pmCherry-1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4880)
  AUTHORS   Oh RS, Pan WC, Yalcin A, Zhang H, Guilarte TR, Hotamisligil GS, 
            Christiani DC, Lu Q
  TITLE     Functional RNA Interference (RNAi) Screen Identifies System A 
            Neutral Amino Acid Transporter 2 (SNAT2) as a Mediator of 
            Arsenic-induced Endoplasmic Reticulum Stress.
  JOURNAL   J Biol Chem. 2012 Feb 17;287(8):6025-34. Epub 2012 Jan 3.
  PUBMED    22215663
REFERENCE   2  (bases 1 to 4880)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Biol 
            Chem."; date: "2012-02-17"; volume: "287(8)"; pages: "6025-34. Epub 
            2012 Jan 3"
FEATURES             Location/Qualifiers
     source          1..4880
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     regulatory      831..840
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             837..1547
                     /codon_start=1
                     /product="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
                     /label=mCherry
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
                     TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
                     GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
                     EGRHSTGGMDELYK"
     primer_bind     complement(982..1000)
                     /label=mCherry-R
                     /note="mCherry, reverse primer"
     primer_bind     1250..1269
                     /label=mCherry-F
                     /note="mCherry, forward primer"
     polyA_signal    1668..1789
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(1705..1724)
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     1759..1778
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     rep_origin      complement(1796..2251)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(1933..1954)
                     /label=F1ori-F
                     /note="F1 origin, forward primer"
     primer_bind     2145..2164
                     /label=F1ori-R
                     /note="F1 origin, reverse primer"
     promoter        2278..2382
                     /gene="bla"
                     /label=AmpR promoter
     promoter        2384..2741
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     primer_bind     complement(2407..2427)
                     /label=pBABE 3'
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     rep_origin      2592..2727
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     2654..2673
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     CDS             2776..3570
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(2830..2849)
                     /label=Neo-R
                     /note="Neomycin resistance gene, reverse primer"
     primer_bind     3440..3459
                     /label=Neo-F
                     /note="Neomycin resistance gene, forward primer"
     primer_bind     complement(3758..3777)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    3802..3849
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      4178..4766
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     4667..4686
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"

This page is informational only.