pCEV-G2-Ph vector (V008566)

LOCUS       40924_10421        6558 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pCEV-G2-Ph, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6558)
  AUTHORS   Behrendorff JB, Vickers CE, Chrysanthopoulos P, Nielsen LK.
  TITLE     2,2-Diphenyl-1-picrylhydrazyl as a screening tool for recombinant 
            monoterpene biosynthesis
  JOURNAL   Microb. Cell Fact. 12 (1), 76 (2013)
  PUBMED    23968454
REFERENCE   2  (bases 1 to 6558)
  AUTHORS   Vickers CE.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAY-2013) Australian Institute for Bioengineering and 
            Nanotechnology, The University of Queensland, Cnr College and Cooper
            Rds, St Lucia, QLD 4072, Australia
REFERENCE   3  (bases 1 to 6558)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6558)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Microb. 
            Cell Fact."; date: "2013"; volume: "12"; issue: "1"; pages: "76"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-MAY-2013) Australian Institute for Bioengineering and 
            Nanotechnology, The University of Queensland, Cnr College and Cooper
            Rds, St Lucia, QLD 4072, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6558
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(2..167)
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae
                     alcohol dehydrogenase 1 (ADH1) gene"
     CDS             complement(315..338)
                     /label=FLAG
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     regulatory      complement(360..1343)
                     /label=Saccharomyces cerevisiae PGK1 promoter
                     /note="Saccharomyces cerevisiae PGK1 promoter"
                     /regulatory_class="promoter"
     promoter        1353..1760
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        1780..1798
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1816..1845
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
     terminator      1875..2064
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(2307..2895)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3069..3926)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3927..4031)
                     /label=AmpR promoter
     rep_origin      complement(4058..5400)
                     /direction=LEFT
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     protein_bind    5420..5453
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     promoter        5508..5851
                     /label=TEF promoter
                     /note="Ashbya gossypii TEF promoter"
     CDS             5852..6238
                     /codon_start=1
                     /gene="ble"
                     /product="bleomycin resistance protein"
                     /label=ble
                     /protein_id="AGV68806.1"
                     /translation="MGMTDQATPNLPSRDFDPTAAFYERLGFGIVFRDAGWMILQRGDL
                     MLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGT
                     MAALVDPDGTLLRLIQNELLAGIS"
     gene            5852..6238
                     /gene="ble"
                     /label=ble
     terminator      6244..6441
                     /label=TEF terminator
                     /note="Ashbya gossypii TEF terminator"
     misc_recomb     6504..6537
                     /label=loxP recognition sequence for Cre recombinase
                     /note="loxP recognition sequence for Cre recombinase"
     protein_bind    complement(6504..6537)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."