Basic Vector Information
- Vector Name:
- pCEV-G1-Ph
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6558 bp
- Type:
- Cloning and expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Vickers CE, Bydder SF, Zhou Y, Nielsen LK.
- Promoter:
- TEF1
pCEV-G1-Ph vector Map
pCEV-G1-Ph vector Sequence
LOCUS 40924_10411 6558 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning and expression vector pCEV-G1-Ph, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6558)
AUTHORS Vickers CE, Bydder SF, Zhou Y, Nielsen LK.
TITLE Dual gene expression cassette vectors with antibiotic selection
markers for engineering in Saccharomyces cerevisiae
JOURNAL Microb. Cell Fact. 12 (1), 96 (2013)
PUBMED 24161108
REFERENCE 2 (bases 1 to 6558)
AUTHORS Bydder SF, Vickers CE.
TITLE Direct Submission
JOURNAL Submitted (08-JUL-2013) AIBN, The University of Queensland, Crn
College and Cooper Roads (Bldg 75), St Lucia, QLD 4072, Australia
REFERENCE 3 (bases 1 to 6558)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6558)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microb.
Cell Fact."; date: "2013"; volume: "12"; issue: "1"; pages: "96"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(08-JUL-2013) AIBN, The University of Queensland, Crn College and
Cooper Roads (Bldg 75), St Lucia, QLD 4072, Australia"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6558
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(2..167)
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
CDS complement(315..338)
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
promoter complement(372..779)
/label=TEF1 promoter
/note="promoter for EF-1-alpha"
regulatory 790..1771
/label=PGK1 promoter from Saccharomyces cerevisiae CEN.PK
/note="PGK1 promoter from Saccharomyces cerevisiae CEN.PK"
/regulatory_class="promoter"
promoter 1780..1798
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 1816..1845
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
terminator 1875..2064
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(2307..2895)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3069..3926)
/label=AmpR
/note="beta-lactamase"
promoter complement(3927..4031)
/label=AmpR promoter
rep_origin complement(4058..5400)
/direction=LEFT
/label=2u ori
/note="yeast 2u plasmid origin of replication"
protein_bind 5420..5453
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
promoter 5508..5851
/label=TEF promoter
/note="Ashbya gossypii TEF promoter"
CDS 5852..6238
/codon_start=1
/gene="ble"
/product="bleomycin resistance protein"
/label=ble
/protein_id="AGZ03669.1"
/translation="MGMTDQATPNLPSRDFDPTAAFYERLGFGIVFRDAGWMILQRGDL
MLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGT
MAALVDPDGTLLRLIQNELLAGIS"
gene 5852..6238
/gene="ble"
/label=ble
terminator 6244..6441
/label=TEF terminator
/note="Ashbya gossypii TEF terminator"
misc_recomb 6504..6537
/label=loxP recognition sequence for Cre recombinase
/note="loxP recognition sequence for Cre recombinase"
protein_bind complement(6504..6537)
/label=loxP
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
This page is informational only.