Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V007586 | pEKEx2 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pEKEx2 is a plasmid vector carrying an IPTG-inducible tac promoter, designed for the expression of the heterologous fatty acyl-CoA reductase Maqu_2220/Maqu_2507 in Bacillus glutamic acidum. This enzyme catalyses the conversion of fatty acids into fatty alcohols.
- Vector Name:
- pEKEx2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8161 bp
- Type:
- Shuttle-expression vector
- Replication origin:
- ori
- Source/Author:
- Krumbach K, Eggeling L, Eikmanns B.
- Growth Strain(s):
- DH10B
pEKEx2 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Werner F, Schwardmann LS, Siebert D, Rückert-Reed C, Kalinowski J, Wirth MT, Hofer K, Takors R, Wendisch VF, Blombach B. Metabolic engineering of Corynebacterium glutamicum for fatty alcohol production from glucose and wheat straw hydrolysate. Biotechnol Biofuels Bioprod. 2023 Jul 18;16(1):116. doi: 10.1186/s13068-023-02367-3. PMID: 37464396; PMCID: PMC10355004.
pEKEx2 vector Sequence
LOCUS 40924_17299 8161 bp DNA circular SYN 17-DEC-2018
DEFINITION Shuttle-expression vector pEKEx2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8161)
AUTHORS Krumbach K, Eggeling L, Eikmanns B.
TITLE Direct Submission
JOURNAL Submitted (30-MAR-2004) Biotechnology, Forschungszentrum, Leo-Brand,
Juelich, NRW 52425, Germany
REFERENCE 2 (bases 1 to 8161)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 8161)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(30-MAR-2004) Biotechnology, Forschungszentrum, Leo-Brand, Juelich,
NRW 52425, Germany"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8161
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(1..57)
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(58..74)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
terminator 287..373
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 465..492
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 511..602
/label=AmpR promoter
primer_bind complement(923..939)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(947..963)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(971..1001)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1016..1037)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1325..1913)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS 2146..2958
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
CDS 4577..5860
/codon_start=1
/product="replicase"
/label=replicase
/note="orf-1 from Corynebacterium glutamicum pBL1"
/protein_id="AAS99552.1"
/translation="MNTSKEPQVNEGSKVTRARAWRRQNVMYKITNSKALAGCHRWRRD
EAVAVSWSSNGASQFEGLQNSHSRWGSPLAELEVMGERRIELAIATKNHLAAGGALMMF
VGTVRHNRSQSFAQVEAGIKTAYSSMVKTSQWKKERARYGVEHTYSDYEVTDSWANGWH
LHRNMLLFLDRPLSDDELKAFEDSMFSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDA
AKMATYLAKGMSQELTGSATKTASKGSYTPFQMLDMLADQSDAGEDMDAVLVARWREYE
VGSKNLRSSWSRGAKRALGIDYIDADVRREMEEELYKLAGLEAPERVESTRVAVALVKP
DDWKLIQSDFAVRQYVLDCVDKAKDVAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAV
LPTHGDATKRDLNAAVFAGNEQTILRTH"
promoter complement(6581..6609)
/label=tet promoter
/note="E. coli promoter for tetracycline efflux protein
gene"
CDS complement(6724..7752)
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ASA"
promoter complement(7753..7830)
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
promoter 8064..8092
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 8100..8116
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."