pDGO145 vector (V007999)

LOCUS       V007999                 6950 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V007999
VERSION     V007999
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6950)
  AUTHORS   Hon S, Olson DG, Holwerda EK, Lanahan AA, Murphy SJL., Maloney MI,
            Zheng T, Papanek B, Guss AM, Lynd LR.
  TITLE     The ethanol pathway from Thermoanaerobacterium saccharolyticum
            improves ethanol production in Clostridium thermocellum
  JOURNAL   Metab. Eng. 42, 175-184 (2017)
   PUBMED   28663138
REFERENCE   2  (bases 1 to 6950)
  AUTHORS   Hon S, Olson DG, Holwerda EK, Lanahan AA, Murphy SJL., Maloney MI,
            Zheng T, Papanek BA, Guss AM, Lynd LR.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAR-2017) Thayer School of Engineering, Dartmouth
            College, 14 Engineering Drive, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 6950)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6950)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng.
            42, 175-184 (2017)"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (28-MAR-2017) Thayer School of Engineering, Dartmouth College, 14
            Engineering Drive, Hanover, NH 03755, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6950
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(1..579)
                     /codon_start=1
                     /gene="tdk"
                     /product="Tdk"
                     /label="tdk"
                     /note="thymidine kinase"
                     /protein_id="ASK05960.1"
                     /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
                     IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
                     ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
                     ANYDDPIIMVGAKESYEARCRKCHEVPRT"
     gene            complement(1..579)
                     /gene="tdk"
                     /label="tdk"
     regulatory      complement(580..1200)
                     /label="C therm cbp promoter"
                     /note="C therm cbp promoter"
                     /regulatory_class="promoter"
     CDS             complement(1279..2280)
                     /label="repB"
                     /note="RepB replication protein"
     rep_origin      complement(2281..2735)
                     /direction=LEFT
                     /label="C thermocellum replication origin"
                     /note="C thermocellum replication origin"
     CDS             complement(2841..3698)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(3699..3803)
                     /label="AmpR promoter"
     regulatory      3896..4470
                     /label="C therm gapDH promoter"
                     /note="C therm gapDH promoter"
                     /regulatory_class="promoter"
     CDS             4471..5118
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             5139..5684
                     /codon_start=1
                     /gene="hpt"
                     /product="Hpt"
                     /label="hpt"
                     /note="hypoxanthine phosphoribosyltransferase"
                     /protein_id="ASK05964.1"
                     /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK
                     GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII
                     DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD
                     EKYRNLPFIGVLKPEMYS"
     gene            5139..5684
                     /gene="hpt"
                     /label="hpt"
     terminator      5901..6089
                     /label="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     rep_origin      6139..6684
                     /direction=RIGHT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."