Cart 2

PCY vector (V008080#)

Basic Vector Information

Basic Vector Information
Vector Name PCY Antibiotic Resistance Kanamycin
Length 10347 bp Type Shuttle vector
Source Cui T, Song Z.

PCY vector Vector Map

derived from gene 2x35S mgfp5 NOS terminator right border repeat from nopaline C58 T-DNA pVS1 StaA pVS1 RepA origin of replication for the Pseudomonas plasmid pVS1 basis of mobility region from pBR322 high copy number ColE1/pMB1/pBR322/pUC origin of replication aphA-3 TRP1 TRP1 promoter S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence AmpR promoter left border repeat from nopaline C58 T-DNA

PCY vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               10347 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector PCY, complete sequence.
ACCESSION   MG637043
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10347)
  AUTHORS   Cui T, Song Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-DEC-2017) Citrus Research Institute, Southwest 
            University, Xie ma, Beibei, Chongqing 400712, China
REFERENCE   2  (bases 1 to 10347)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10347
                     /organism="Shuttle vector PCY"
                     /mol_type="other DNA"
                     /label=Ternary shuttle vector
                     /note="Ternary shuttle vector"
                     /db_xref="taxon:2282650"
     regulatory      1..767
                     /regulatory_class="promoter"
                     /note="derived from gene 2x35S"
     promoter        722..767
                     /label=minimal CaMV 35S promoter
                     /note="minimal 35S promoter from cauliflower mosaic virus"
     gene            771..1487
                     /gene="mgfp5"
                     /label=mgfp5
                     /note="suitable for expression in plants due to removal of 
                     a cryptic intron"
     CDS             771..1487
                     /codon_start=1
                     /gene="mgfp5"
                     /product="GFP with folding enhancement mutations"
                     /label=mgfp5
                     /note="suitable for expression in plants due to removal of 
                     a cryptic intron"
                     /translation="MSKGEELFTGVVPILVELDGDVNGYKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNFHNVYIMADKQKNGIKA
                     NFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
     misc_feature    1589..1841
                     /note="NOS terminator; nopaline synthase terminator and 
                     poly(A) signal"
     terminator      1589..1841
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     repeat_region   1863..1887
                     /label=right border repeat from nopaline C58 T-DNA
                     /note="right border repeat from nopaline C58 T-DNA"
     misc_feature    1863..1887
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             3187..3816
                     /codon_start=1
                     /product="pVS1 StaA"
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1"
                     /protein_id="AXG50152.1"
                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR
                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP
                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI
                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
     CDS             4211..5317
                     /codon_start=1
                     /product="pVS1 RepA"
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid 
                     pVS1"
                     /protein_id="AXG50153.1"
                     /translation="MALEPPSPRNRRDGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQR
                     IEAEARPGESWQAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSR
                     SIMDVAVFRLSKRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESM
                     NRYREGKGDKPGRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAK
                     NGRLVTVSEGEALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFL
                     IDPGIGRFLYRLARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYD
                     LKEEAGQAGPILVMRYRNLIEGEASAGS"
     CDS             4250..5317
                     /codon_start=1
                     /product="replication protein from the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
                     /label=pVS1 RepA
                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA
                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR
                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR
                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL
                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA
                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV
                     MRYRNLIEGEASAGS"
     rep_origin      5383..5577
                     /note="origin of replication for the Pseudomonas plasmid 
                     pVS1"
     misc_feature    5921..6061
                     /label=basis of mobility region from pBR322
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(6247..6835)
                     /direction=LEFT
                     /note="high copy number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(6922..7716)
                     /codon_start=1
                     /gene="aphA-3"
                     /product="KanR"
                     /label=aphA-3
                     /note="confers resistance to kanamycin"
                     /protein_id="AXG50154.1"
                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM
                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED
                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT
                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA
                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
     gene            complement(6922..7716)
                     /gene="aphA-3"
                     /label=aphA-3
                     /note="aminoglycoside phosphotransferase"
     CDS             complement(8055..8729)
                     /codon_start=1
                     /gene="TRP1"
                     /product="TRP1"
                     /label=TRP1
                     /note="yeast auxotrophic marker"
                     /protein_id="AXG50155.1"
                     /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
                     RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQLKEDVLALVNDYGIDIVQLHGDES
                     WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
                     VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
                     KK"
     gene            complement(8055..8729)
                     /gene="TRP1"
                     /label=TRP1
                     /note="derived from S. cerevisiae"
     regulatory      complement(8730..9010)
                     /regulatory_class="promoter"
                     /note="TRP1 promoter"
     promoter        complement(8730..9010)
                     /gene="S. cerevisiae TRP1"
                     /label=TRP1 promoter
     misc_feature    9269..9772
                     /note="S. cerevisiae CEN6 centromere fused to an 
                     autonomously replicating sequence"
     regulatory      9809..9913
                     /regulatory_class="promoter"
                     /note="AmpR promoter"
     promoter        9809..9913
                     /gene="bla"
                     /label=AmpR promoter
     repeat_region   10258..10282
                     /note="left border repeat from nopaline C58 T-DNA; LB T-DNA
                     repeat"
     misc_feature    10258..10282
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"

This page is informational only.