2XMyc-LRRK2-WT vector (V012134)

Basic Vector Information

      • Vector Name:
      • 2XMyc-LRRK2-WT
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 11985 bp
      • Type:
      • Mammalian Expression
      • Copy Number:
      • High Copy
      • Cloning Method:
      • Restriction Enzyme
      • 5' Primer:
      • CMV-F
      • 3' Primer:
      • SV40pA-R

2XMyc-LRRK2-WT vector Vector Map

2XMyc-LRRK2-WT11985 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000105001100011500CMV enhancerCMV promoterT3 promoterKozak sequenceMycMycattB1attB2T7SV40 poly(A) signalf1 oriAmpR promoterSV40 promoterNeoR/KanRTK-pA-RHSV TK poly(A) signalori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

2XMyc-LRRK2-WT vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               11985 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    2XMyc-LRRK2-WT
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11985)
  TITLE     The Parkinson Disease-associated Leucine-rich Repeat Kinase 2 
            (LRRK2) Is a Dimer That Undergoes Intramolecular Autophosphorylation
  JOURNAL   J Biol Chem. 2008 Jun 13;283(24):16906-14.
  PUBMED    18397888
REFERENCE   2  (bases 1 to 11985)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Biol 
            Chem."; date: "2008-06-13"; volume: "283(24)"; pages: "16906-14"
FEATURES             Location/Qualifiers
     source          1..11985
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        68..371
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        372..575
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     primer_bind     526..546
                     /label=CMV-F
                     /note="Human CMV immediate early promoter, forward primer"
     promoter        621..639
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     regulatory      671..680
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             680..709
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             725..754
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     protein_bind    773..797
                     /gene="mutant version of attB"
                     /label=attB1
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     protein_bind    complement(8414..8438)
                     /gene="mutant version of attB"
                     /label=attB2
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     primer_bind     complement(8487..8506)
                     /label=T7
                     /note="T7 promoter, forward primer"
     promoter        complement(8488..8506)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     polyA_signal    8780..8901
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(8817..8836)
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     8871..8890
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     rep_origin      complement(8908..9363)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(9045..9066)
                     /label=F1ori-F
                     /note="F1 origin, forward primer"
     primer_bind     9257..9276
                     /label=F1ori-R
                     /note="F1 origin, reverse primer"
     promoter        9390..9494
                     /gene="bla"
                     /label=AmpR promoter
     promoter        9496..9853
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     primer_bind     complement(9519..9539)
                     /label=pBABE 3'
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     rep_origin      9704..9839
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     9766..9785
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     CDS             9888..10682
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(9942..9961)
                     /label=Neo-R
                     /note="Neomycin resistance gene, reverse primer"
     primer_bind     10552..10571
                     /label=Neo-F
                     /note="Neomycin resistance gene, forward primer"
     primer_bind     complement(10870..10889)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    10914..10961
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      11290..11878
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     11779..11798
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"

This page is informational only.