Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V009302 | PBAD1030A | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
PBAD1030A vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
PBAD1030A vector Sequence
LOCUS Exported 3586 bp DNA circular SYN 29-NOV-2023 DEFINITION Cloning vector PBAD1030A, complete sequence. ACCESSION KP899255 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3586) AUTHORS Chakravartty V, Cronan JE. TITLE A series of medium and high copy number arabinose-inducible Escherichia coli expression vectors compatible with pBR322 and pACYC184 JOURNAL Plasmid 81, 21-26 (2015) PUBMED 26021570 REFERENCE 2 (bases 1 to 3586) AUTHORS Chakravartty V, Cronan JE. TITLE Direct Submission JOURNAL Submitted (06-MAR-2015) Microbiology, University of Illinois, 601S. Goodwin Ave, Urbana, IL 61801, USA REFERENCE 3 (bases 1 to 3586) TITLE Direct Submission REFERENCE 4 (bases 1 to 3586) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid 81, 21-26 (2015)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-MAR-2015) Microbiology, University of Illinois, 601S. Goodwin Ave, Urbana, IL 61801, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3586 /mol_type="other DNA" /db_xref="taxon:1670622" /organism="Cloning vector PBAD1030A" CDS complement(96..974) /codon_start=1 /gene="araC" /product="AraC" /label=araC /note="transcription factor" /protein_id="AKM76960.1" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" gene complement(96..974) /gene="araC" /label=araC promoter 1001..1285 /gene="araBAD" /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" terminator 1569..1655 /gene="Escherichia coli rrnB" /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1747..1774 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" misc_feature complement(1834..2462) /label=RSF ori /note="Plasmids containing the RSF 1030 origin ofreplication can be propagated in E. coli cells that contain additional plasmids with compatible origins." promoter 2479..2583 /gene="bla" /label=AmpR promoter CDS 2584..3444 /codon_start=1 /gene="bla" /product="beta-lactamase" /label=bla /note="ampicillin resistance" /protein_id="AKM76961.1" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" gene 2584..3444 /gene="bla" /label=bla