Basic Vector Information
- Vector Name:
- pBACOV
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5396 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
pBACOV vector Map
pBACOV vector Sequence
LOCUS 40924_5654 5396 bp DNA circular SYN 17-DEC-2018
DEFINITION Shuttle vector pBACOV, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5396)
AUTHORS Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
TITLE Conjugative transfer of a new broad host range expression vector to
various Bacillus species using a single protocol
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5396)
AUTHORS Heinze S, Kornberger P, Graetz C, Schwarz WH, Zverlov VV, Liebl W.
TITLE Direct Submission
JOURNAL Submitted (01-DEC-2017) Department for Microbiology, Technical
University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354,
Germany
REFERENCE 3 (bases 1 to 5396)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5396)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-DEC-2017) Department for Microbiology, Technical University of
Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5396
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(79..667)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(841..1698)
/label=AmpR
/note="beta-lactamase"
promoter complement(1699..1803)
/label=AmpR promoter
CDS complement(1832..2116)
/codon_start=1
/gene="traJ"
/product="TraJ"
/label=traJ
/protein_id="AWI97856.1"
/translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH"
gene complement(1832..2116)
/gene="traJ"
/label=traJ
/note="required for conjugation"
oriT complement(2149..2258)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
CDS complement(2515..3276)
/codon_start=1
/gene="kanR"
/product="kanamycin resistance protein"
/label=kanR
/note="KanR"
/protein_id="AWI97857.1"
/translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD
GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF
SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP
SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK
LLESLENFWNGIQEWTERHGYIVDVSKRIPF"
gene complement(2515..3276)
/gene="kanR"
/label=kanR
/note="for selection in Bacillus"
CDS complement(3448..4449)
/label=repB
/note="RepB replication protein"
regulatory 4866..5031
/label=aprE promoter from Bacillus subtilis
/note="aprE promoter from Bacillus subtilis"
/regulatory_class="promoter"
regulatory 4960..4969
/regulatory_class="minus_35_signal"
regulatory 4987..4992
/regulatory_class="minus_10_signal"
regulatory 5042..5046
/regulatory_class="ribosome_binding_site"
misc_feature 5057..5143
/note="aprE signal peptide from Bacillus subtilis for
secretory protein expression; aprE-SP"
misc_feature 5156..5215
/label=multiple cloning site (MCS)
/note="multiple cloning site (MCS)"
CDS 5216..5233
/label=6xHis
/note="6xHis affinity tag"
This page is informational only.