Basic Vector Information
- Vector Name:
- pAY201
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12408 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Host:
- Yeast
- Source/Author:
- Scholz P, Haring V, Wittmann-Liebold B, Ashman K, Bagdasarian M, Scherzinger E.
- Promoter:
- URA3
pAY201 vector Map
pAY201 vector Sequence
LOCUS 40924_5149 12408 bp DNA circular SYN 17-DEC-2018
DEFINITION Shuttle vector pAY201 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12408)
AUTHORS Scholz P, Haring V, Wittmann-Liebold B, Ashman K, Bagdasarian M,
Scherzinger E.
TITLE Complete nucleotide sequence and gene organization of the
broad-host-range plasmid RSF1010
JOURNAL Gene 75 (2), 271-288 (1989)
PUBMED 2653965
REFERENCE 2 (bases 1 to 12408)
AUTHORS Nishikawa M, Suzuki K, Yoshida K.
TITLE Structural and functional stability of IncP plasmids during stepwise
transmission by trans-kingdom mating: promiscuous conjugation of
Escherichia coli and Saccharomyces cerevisiae
JOURNAL Jpn. J. Genet. 65 (5), 323-334 (1990)
PUBMED 2248784
REFERENCE 3 (bases 1 to 12408)
AUTHORS Nishikawa M, Suzuki K, Yoshida K.
TITLE DNA integration into recipient yeast chromosomes by trans-kingdom
conjugation between Escherichia coli and Saccharomyces cerevisiae
JOURNAL Curr. Genet. 21 (2), 101-108 (1992)
PUBMED 1568253
REFERENCE 4 (bases 1 to 12408)
AUTHORS Nishikawa M, Moriguchi K, Suzuki K.
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2009) Contact:Kazuki Moriguchi Hiroshima
University, Department of Biological Science, Graduate School of
Science; Kagamiyama 1-3-1, Higashi-Hiroshima, Hiroshima 739-8526,
Japan
REFERENCE 5 (bases 1 to 12408)
TITLE Direct Submission
REFERENCE 6 (bases 1 to 12408)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene";
date: "1989"; volume: "75"; issue: "2"; pages: "271-288"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Jpn. J.
Genet."; date: "1990"; volume: "65"; issue: "5"; pages: "323-334"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Curr.
Genet."; date: "1992"; volume: "21"; issue: "2"; pages: "101-108"
COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Submitted
(19-OCT-2009) Contact:Kazuki Moriguchi Hiroshima University,
Department of Biological Science, Graduate School of Science;
Kagamiyama 1-3-1, Higashi-Hiroshima, Hiroshima 739-8526, Japan"
COMMENT SGRef: number: 5; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12408
/mol_type="other DNA"
/organism="synthetic DNA construct"
source 9762..9869
/mol_type="other DNA"
/db_xref="taxon:2504"
/organism="Plasmid RSF1010"
rep_origin complement(396..790)
/direction=LEFT
/label=RSF1010 oriV
/note="replication origin of the broad-host-range plasmid
RSF1010; requires the RSF1010 RepA/B/C proteins for
replication (Scholz et al., 1989)"
CDS complement(817..1101)
/codon_start=1
/gene="mobC"
/product="MobC"
/label=mobC
/protein_id="BAI47951.1"
/translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRK
VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
gene complement(817..1101)
/gene="mobC"
/label=mobC
oriT 1132..1219
/label=RSF1010 oriT
/note="origin of transfer of the broad-host-range plasmid
RSF1010 (Scholz et al., 1989)"
CDS 2048..2461
/codon_start=1
/gene="mobB"
/product="MobB"
/label=mobB
/protein_id="BAI47953.1"
/translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQAS
EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
gene 2048..2461
/gene="mobB"
/label=mobB
CDS 2458..3426
/label=RSF1010 RepB
/note="replication protein B of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 3490..3702
/codon_start=1
/product="unknown protein E"
/label=unknown protein E
/note="unknown protein E gene"
/protein_id="BAI47955.1"
/translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
LNLDGCTLSLFREDKPFGPGKFLGD"
CDS 3704..3910
/codon_start=1
/product="repressor protein F"
/label=repressor protein F
/note="repressor protein F gene"
/protein_id="BAI47956.1"
/translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
EALRECLEELRAAQGGGSDPASA"
CDS 3940..4776
/label=RSF1010 RepA
/note="replication protein A of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS 4766..5614
/label=RSF1010 RepC
/note="replication protein C of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
misc_feature 5821..6137
/gene="bla"
/label=beta-lactamase, C-terminus region
/note="beta-lactamase, C-terminus region"
gene 5821..6137
/gene="bla"
/label=bla
rep_origin 6302..6847
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS 7442..8254
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature 8544..9035
/gene="tnpR"
/label=transposon Tn3 resolvase, C-terminus region
/note="transposon Tn3 resolvase, C-terminus region"
gene 8544..9035
/gene="tnpR"
/label=tnpR
promoter 9113..9217
/label=AmpR promoter
misc_feature 9218..9761
/gene="bla"
/label=beta-lactamase, N-terminus region
/note="beta-lactamase, N-terminus region"
gene 9218..9761
/gene="bla"
/label=bla
promoter 9879..9907
/label=tet promoter
/note="E. coli promoter for tetracycline efflux protein
gene"
CDS 9955..11142
/label=TcR
/note="tetracycline efflux protein"
promoter 11306..11526
/label=URA3 promoter
CDS 11527..12327
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
regulatory 12331..12408
/gene="URA3"
/label=terminator region of URA3
/note="terminator region of URA3"
/regulatory_class="terminator"
This page is informational only.