pAS2.1htBID vector (V009432)

LOCUS       V009432                 8781 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V009432
VERSION     V009432
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8781)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8781)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 8781)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8781)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
            9052, BELGIUM"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8781
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(2..1344)
                     /direction=LEFT
                     /label="2u ori"
                     /note="yeast 2u plasmid origin of replication"
     promoter        1603..1883
                     /label="TRP1 promoter"
     CDS             1884..2555
                     /label="TRP1"
                     /note="phosphoribosylanthranilate isomerase, required for
                     tryptophan biosynthesis"
     rep_origin      complement(2661..3116)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     3261..3277
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     terminator      complement(3314..3561)
                     /label="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     CDS             complement(3858..4304)
                     /gene="RPL28"
                     /label="Large ribosomal subunit protein uL15"
                     /note="Large ribosomal subunit protein uL15 from
                     Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
                     Accession#: P02406"
     promoter        4769..5473
                     /label="ADH1 promoter"
                     /note="promoter for alcohol dehydrogenase 1"
     CDS             5501..5941
                     /label="GAL4 DNA binding domain"
                     /note="DNA binding domain of the GAL4 transcriptional
                     activator"
     CDS             5984..6391
                     /codon_start=1
                     /note="unnamed protein product; htBID"
                     /protein_id="SJL87250.1"
                     /translation="GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGL
                     VNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTP
                     SLLRDVFHTTVNFINQNLRTYVRSLARNGMD"
     terminator      6419..6606
                     /label="ADH1 terminator"
                     /note="transcription terminator for the S. cerevisiae
                     alcohol dehydrogenase 1 (ADH1) gene"
     primer_bind     complement(6630..6646)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(6654..6670)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6678..6708)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6723..6744)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(7032..7620)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(7794..8651)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8652..8756)
                     /label="AmpR promoter"