Basic Vector Information
- Vector Name:
- pARO191
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5963 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Okamoto S.
- Promoter:
- lac
pARO191 vector Map
pARO191 vector Sequence
LOCUS 40924_4759 5963 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pARO191 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5963)
AUTHORS Okamoto S.
TITLE cloning vector pARO191 sequence
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5963)
AUTHORS Okamoto S, Niki H.
TITLE Direct Submission
JOURNAL Submitted (31-MAR-2016) Contact:Sho Okamoto National Institute of
Genetics, Microbial Genetics Laboratory, Genetics Strains Research
Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL
:https://www.nig.ac.jp/labs/MicroGen/
REFERENCE 3 (bases 1 to 5963)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5963)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(31-MAR-2016) Contact:Sho Okamoto National Institute of Genetics,
Microbial Genetics Laboratory, Genetics Strains Research Center;
1111 Yata, Mishima, Shizuoka 411-8540, Japan URL
:https://www.nig.ac.jp/labs/MicroGen/"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5963
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 925..941
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 942..998
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(1011..1027)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1035..1051)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1059..1089)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1104..1125)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin 1413..2001
/label=pMB1 ori
/note="pMB1 ori"
misc_feature 2427..2567
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(2753..3341)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4377..5189)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
oriT complement(5443..5552)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
terminator 5604..5647
/label=bacterial terminator
/note="putative bacterial transcription terminator"
This page is informational only.