pAK501 vector (V009535)

LOCUS       40924_4284        9903 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pAK501, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9903)
  AUTHORS   Kaczmarczyk A, Vorholt JA, Francez-Charlot A.
  TITLE     Cumate-inducible gene expression system for sphingomonads and other 
            alphaproteobacteria
  JOURNAL   Appl. Environ. Microbiol. 79 (21), 6795-6802 (2013)
  PUBMED    23995928
REFERENCE   2  (bases 1 to 9903)
  AUTHORS   Kaczmarczyk A.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-2013) Department of Biology, Institute of 
            Microbiology, ETH Zurich, Wolfgang-Pauli-Str. 10, Zurich 8093, 
            Switzerland
REFERENCE   3  (bases 1 to 9903)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9903)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2013"; volume: "79"; issue: "21"; 
            pages: "6795-6802"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-AUG-2013) Department of Biology, Institute of Microbiology, ETH 
            Zurich, Wolfgang-Pauli-Str. 10, Zurich 8093, Switzerland"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9903
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      38..172
                     /label=putative transcriptional terminator TERM193
                     /note="putative transcriptional terminator TERM193"
                     /regulatory_class="terminator"
     misc_feature    200..231
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             246..3317
                     /label=lacZ
                     /note="beta-galactosidase"
     promoter        3938..4040
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             4041..4697
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     misc_feature    complement(4793..4814)
                     /label=p15A origin of transfer
                     /note="p15A origin of transfer"
     rep_origin      complement(5056..5601)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     rep_origin      complement(6311..6505)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(6574..7644)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    complement(7794..7806)
                     /label=KorB box
                     /note="KorB box"
     CDS             complement(7837..8052)
                     /codon_start=1
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /protein_id="AGU99850.1"
                     /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT
                     KLKMYAVRQGKTITELLSEYIAQLPE"
     CDS             complement(8076..8702)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             complement(8789..9004)
                     /codon_start=1
                     /product="hypothetical protein"
                     /label=hypothetical protein
                     /protein_id="AGU99852.1"
                     /translation="MKPHQDGQDEPFFITEEIEAEMIAAGYVFEPPAHVSTVRLHEILA
                     GLSDAKLAAWPASLAAEETERRRLKR"
     CDS             complement(9001..9687)
                     /codon_start=1
                     /product="pVS1 resolvase"
                     /label=pVS1 resolvase
                     /protein_id="AGU99853.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"