pAJM.847 vector (V009542)

LOCUS       40924_4249        3834 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pAJM.847, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3834)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Marionette: E. coli containing 12 highly-optimized small molecule 
            sensors
  JOURNAL   bioRxivorg 285866, 1-26 (2018)
REFERENCE   2  (bases 1 to 3834)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2018) Synthetic Biology Center, Department of 
            Biological Engineering, Massachusetts Institute of Technology, 77 
            Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 3834)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3834)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg 
            285866, 1-26 (2018)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-MAR-2018) Synthetic Biology Center, Department of Biological 
            Engineering, Massachusetts Institute of Technology, 77 Massachusetts
            Avenue, Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3834
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..53
                     /label=L3S3P21
                     /note="L3S3P21"
                     /regulatory_class="terminator"
     regulatory      73..138
                     /label=PPhlF
                     /note="PPhlF"
                     /regulatory_class="promoter"
     regulatory      104..109
                     /regulatory_class="minus_35_signal"
     misc_feature    109..138
                     /label=PhlO operator
                     /note="PhlO operator"
     regulatory      127..132
                     /regulatory_class="minus_10_signal"
     misc_RNA        140..190
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     regulatory      222..233
                     /label=B0064
                     /note="B0064"
                     /regulatory_class="ribosome_binding_site"
     CDS             240..956
                     /label=EYFP
                     /note="enhanced YFP"
     regulatory      960..1020
                     /label=L3S2P21
                     /note="L3S2P21"
                     /regulatory_class="terminator"
     regulatory      1025..1078
                     /label=PLacIQ
                     /note="PLacIQ"
                     /regulatory_class="promoter"
     regulatory      1043..1048
                     /regulatory_class="minus_35_signal"
     regulatory      1066..1071
                     /regulatory_class="minus_10_signal"
     regulatory      1079..1106
                     /label=phl2
                     /note="phl2"
                     /regulatory_class="ribosome_binding_site"
     CDS             1107..1709
                     /codon_start=1
                     /product="PhlF-AM"
                     /label=PhlF-AM
                     /protein_id="AYJ72227.1"
                     /translation="MARTPSRSSIGSLRSPHTHKAILTSTIEILKECGYSGLSIESVAR
                     RAGAGKPTIYRWWTNKAALIAEVYENEIEQVRKFPDLGSFKADLDFLLHNLWKVWRETI
                     CGEAFRCVIAEAQLDPVTLTQLKDQFMERRREIPKKLVEDAISNGELPKDINRELLLDM
                     IFGFCWYRLLTEQLTVEQDIEEFTFLLINGVCPGTQC"
     regulatory      1719..1973
                     /label=induction operon terminator region
                     /note="induction operon terminator region"
                     /regulatory_class="terminator"
     rep_origin      complement(2285..2830)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(2922..3734)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"