pAJM.773 vector (V009543)

Basic Vector Information

Vector Name:
pAJM.773
Antibiotic Resistance:
Kanamycin
Length:
3951 bp
Type:
Cloning vector
Replication origin:
p15A ori
Source/Author:
Meyer AJ, Segall-Shapiro TH, Voigt CA.

pAJM.773 vector Map

pAJM.7733951 bp60012001800240030003600L3S3P21PVanCCsTRSV HHRzB0064EYFPL3S2P21PLacIQvan2VanR-AMinduction operon terminator regionp15A oriKanR

pAJM.773 vector Sequence

LOCUS       40924_4244        3951 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pAJM.773, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3951)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Marionette: E. coli containing 12 highly-optimized small molecule 
            sensors
  JOURNAL   bioRxivorg 285866, 1-26 (2018)
REFERENCE   2  (bases 1 to 3951)
  AUTHORS   Meyer AJ, Segall-Shapiro TH, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2018) Synthetic Biology Center, Department of 
            Biological Engineering, Massachusetts Institute of Technology, 77 
            Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 3951)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3951)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg 
            285866, 1-26 (2018)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-MAR-2018) Synthetic Biology Center, Department of Biological 
            Engineering, Massachusetts Institute of Technology, 77 Massachusetts
            Avenue, Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3951
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..53
                     /label=L3S3P21
                     /note="L3S3P21"
                     /regulatory_class="terminator"
     regulatory      73..122
                     /label=PVanCC
                     /note="PVanCC"
                     /regulatory_class="promoter"
     misc_feature    73..84
                     /label=VanO operator
                     /note="VanO operator"
     regulatory      84..89
                     /regulatory_class="minus_35_signal"
     regulatory      107..112
                     /regulatory_class="minus_10_signal"
     misc_feature    111..122
                     /label=VanO operator
                     /note="VanO operator"
     regulatory      119
                     /label=+1
                     /note="+1"
                     /regulatory_class="other"
     misc_RNA        124..174
                     /label=sTRSV HHRz
                     /note="hammerhead ribozyme from the tobacco ringspot virus 
                     satellite RNA (Khvorova et al., 2003)"
     regulatory      206..217
                     /label=B0064
                     /note="B0064"
                     /regulatory_class="ribosome_binding_site"
     CDS             224..940
                     /label=EYFP
                     /note="enhanced YFP"
     regulatory      944..1004
                     /label=L3S2P21
                     /note="L3S2P21"
                     /regulatory_class="terminator"
     regulatory      1009..1062
                     /label=PLacIQ
                     /note="PLacIQ"
                     /regulatory_class="promoter"
     regulatory      1027..1032
                     /regulatory_class="minus_35_signal"
     regulatory      1050..1055
                     /regulatory_class="minus_10_signal"
     regulatory      1063..1091
                     /label=van2
                     /note="van2"
                     /regulatory_class="ribosome_binding_site"
     CDS             1092..1826
                     /codon_start=1
                     /product="VanR-AM"
                     /label=VanR-AM
                     /protein_id="AYJ72236.1"
                     /translation="MDMPRIKPGQRVMMALRKMIASGEIKSGERIAEIPTAAALGVSRM
                     PVRIALRSLEQEGLVVRLGARGYAARGVSSDQIRDAIEVRGVLEGFAARRLAERGMTAE
                     THARFVVLIAEGEALFAAGRLNGEDLDRYAAYNQAFHDTLVSAAGNGAVESALARNGFE
                     PFAAAGALALDLMDLSAEYEHLLAAHRQHQAVLDAVSCGDAEGAERIMRDHALAAIRNA
                     KVFEAAASAGAPLGAAWSIRAD"
     regulatory      1836..2090
                     /label=induction operon terminator region
                     /note="induction operon terminator region"
                     /regulatory_class="terminator"
     rep_origin      complement(2402..2947)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(3039..3851)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"

This page is informational only.