Basic Vector Information
- Vector Name:
- pAJM.690
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4098 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Meyer AJ, Segall-Shapiro TH, Voigt CA.
pAJM.690 vector Map
pAJM.690 vector Sequence
LOCUS 40924_4229 4098 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pAJM.690, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4098)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Marionette: E. coli containing 12 highly-optimized small molecule
sensors
JOURNAL bioRxivorg 285866, 1-26 (2018)
REFERENCE 2 (bases 1 to 4098)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (21-MAR-2018) Synthetic Biology Center, Department of
Biological Engineering, Massachusetts Institute of Technology, 77
Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 4098)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4098)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg
285866, 1-26 (2018)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-MAR-2018) Synthetic Biology Center, Department of Biological
Engineering, Massachusetts Institute of Technology, 77 Massachusetts
Avenue, Cambridge, MA 02139, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4098
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..53
/label=L3S3P21
/note="L3S3P21"
/regulatory_class="terminator"
regulatory 73..165
/label=P3B5B
/note="P3B5B"
/regulatory_class="promoter"
misc_feature 73..118
/label=PcaO operator
/note="PcaO operator"
regulatory 129..134
/regulatory_class="minus_35_signal"
regulatory 153..158
/regulatory_class="minus_10_signal"
misc_RNA 167..217
/label=sTRSV HHRz
/note="hammerhead ribozyme from the tobacco ringspot virus
satellite RNA (Khvorova et al., 2003)"
regulatory 249..260
/label=B0064
/note="B0064"
/regulatory_class="ribosome_binding_site"
CDS 267..983
/label=EYFP
/note="enhanced YFP"
regulatory 987..1047
/label=L3S2P21
/note="L3S2P21"
/regulatory_class="terminator"
regulatory 1052..1105
/label=PLacIQ
/note="PLacIQ"
/regulatory_class="promoter"
regulatory 1070..1075
/regulatory_class="minus_35_signal"
regulatory 1093..1098
/regulatory_class="minus_10_signal"
regulatory 1106..1133
/label=pca2
/note="pca2"
/regulatory_class="ribosome_binding_site"
CDS 1134..1970
/codon_start=1
/product="PcaU-AM"
/label=PcaU-AM
/protein_id="AYJ72255.1"
/translation="MWSNMDDKKVKEENILHNSTNKKIIRHEDFVAGISKGMAILDSFG
TDRHRLNITMAAEKTGMTRAAARRHLLTLEYLGYLESDGHYFYLTPKILKFSGSYLGGA
QLPKISQPLLNLLTTQTSLIYSVMVLDGYEAITIARSAAHQQTDRVNPYGLHLGNRLPA
HTTSAGKILLAYLDDHAQQEWLNQYPLQRLTKYTYTNHIDFLRLLSEIKEQGWCYSSEE
HELGVHALAVPIYGQQSRVVAALNIVSPTMRTTKEYLIQHILPLLQETARELRNIL"
regulatory 1983..2237
/label=induction operon terminator region
/note="induction operon terminator region"
/regulatory_class="terminator"
rep_origin complement(2549..3094)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(3186..3998)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.