pAJM.1642 vector (Cat. No.: V009553)
Basic Information
- Name:
- pAJM.1642
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4143 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Meyer AJ, Segall-Shapiro TH, Voigt CA.
pAJM.1642 vector (Cat. No.: V009553) Sequence
LOCUS 40924_4194 4143 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pAJM.1642, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4143)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Marionette: E. coli containing 12 highly-optimized small molecule
sensors
JOURNAL bioRxivorg 285866, 1-26 (2018)
REFERENCE 2 (bases 1 to 4143)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (21-MAR-2018) Synthetic Biology Center, Department of
Biological Engineering, Massachusetts Institute of Technology, 77
Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 4143)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4143)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg
285866, 1-26 (2018)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-MAR-2018) Synthetic Biology Center, Department of Biological
Engineering, Massachusetts Institute of Technology, 77 Massachusetts
Avenue, Cambridge, MA 02139, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4143
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..53
/label=L3S3P21
/note="L3S3P21"
/regulatory_class="terminator"
regulatory 73..298
/label=PCin
/note="PCin"
/regulatory_class="promoter"
misc_feature 225..245
/label=CinO operator
/note="CinO operator"
regulatory 246..251
/regulatory_class="minus_35_signal"
regulatory 269..274
/regulatory_class="minus_10_signal"
misc_RNA 300..350
/label=sTRSV HHRz
/note="hammerhead ribozyme from the tobacco ringspot virus
satellite RNA (Khvorova et al., 2003)"
regulatory 382..393
/label=B0064
/note="B0064"
/regulatory_class="ribosome_binding_site"
CDS 400..1116
/label=EYFP
/note="enhanced YFP"
regulatory 1120..1180
/label=L3S2P21
/note="L3S2P21"
/regulatory_class="terminator"
regulatory 1185..1238
/label=PLacI
/note="PLacI"
/regulatory_class="promoter"
regulatory 1203..1208
/regulatory_class="minus_35_signal"
regulatory 1226..1231
/regulatory_class="minus_10_signal"
regulatory 1239..1266
/label=cin1
/note="cin1"
/regulatory_class="ribosome_binding_site"
CDS 1267..2022
/codon_start=1
/product="CinR-AM"
/label=CinR-AM
/protein_id="AYJ72261.1"
/translation="MIENTYSEKFESAFEQIKAAANVDAAIRILQAEYNLDFVTYHLAQ
TIASKIDSPFVRTTYPDAWVSRYLLNCYVKVDPIIKQGFERQLPFDWSEVEPTPEAYAM
LVDAQKHGIDDNGYSIPVADKAQRRALLSLNAHIPADEWTELVRRCRNEWIEIAHLIHR
KAVYELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFRLG
CTTISAAASRAVQLRIINPYRIRMTRRNW"
regulatory 2028..2282
/label=induction operon terminator region
/note="induction operon terminator region"
/regulatory_class="terminator"
rep_origin complement(2594..3139)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(3231..4043)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.