pCDF-RpALS vector (Cat. No.: V008634)
Basic Information
- Name:
- pCDF-RpALS
- Antibiotic Resistance:
- Streptomycin
- Length:
- 4955 bp
- Type:
- Cloning vector
- Replication origin:
- CloDF13 ori
- Source/Author:
- Kim B, Binkley R, Kim HU, Lee SY.
pCDF-RpALS vector (Cat. No.: V008634) Sequence
LOCUS 40924_9421 4955 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pCDF-RpALS, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4955)
AUTHORS Kim B, Binkley R, Kim HU, Lee SY.
TITLE Metabolic engineering of Escherichia coli for the enhanced
production of l-tyrosine
JOURNAL Biotechnol. Bioeng. (2018) In press
PUBMED 30019750
REFERENCE 2 (bases 1 to 4955)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Direct Submission
JOURNAL Submitted (15-JUN-2018) Dept. Chemical and Biomolecular Engineering,
Korea Advanced Institute of Science and Technology, Daehak-ro 291,
Daejeon 34141, South Korea
REFERENCE 3 (bases 1 to 4955)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4955)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
Bioeng. (2018) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JUN-2018) Dept. Chemical and Biomolecular Engineering, Korea
Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
34141, South Korea"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4955
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 3..27
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 42..64
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 71..1246
/codon_start=1
/gene="ALS"
/product="aloesone synthase"
/label=ALS
/note="derived from Rheum palmatum"
/protein_id="AXN70001.1"
/translation="MADVLQEIRNSQKASGPATVLAIGTAHPPTCYPQADYPDFYFRVC
KSEHMTKLKKKMQFICDRSGIRQRFMFHTEENLGKNPGMCTFDGPSLNARQDMLIMEVP
KLGAEAAEKAIKEWGQDKSRITHLIFCTTTSNDMPGADYQFATLFGLNPGVSRTMVYQQ
GCFAGGTVLRLVKDIAENNKGARVLVVCSEIVAFAFRGPHEDHIDSLIGQLLFGDGAAA
LVVGTDIDESVERPIFQIMSATQATIPNSLHTMALHLTEAGLTFHLSKEVPKVVSDNME
ELMLEAFKPLGITDWNSIFWQVHPGGRAILDKIEEKLELTKDKMRDSRYILSEYGNLTS
ACVLFVMDEMRKRSFREGKQTTGDGYEWGVAIGLGPGLTVETVVLRSVPIP"
gene 71..1246
/gene="ALS"
/label=ALS
CDS 1257..1274
/label=6xHis
/note="6xHis affinity tag"
promoter 1388..1406
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind 1407..1431
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 1540..1584
/label=S-Tag
/note="affinity and epitope tag derived from pancreatic
ribonuclease A"
terminator 1636..1683
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
CDS complement(1857..2645)
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
promoter complement(2646..2737)
/label=AmpR promoter
rep_origin complement(2785..3523)
/direction=LEFT
/label=CloDF13 ori
/note="Plasmids containing the CloDF13 (CDF) origin of
replication can be propagated in E. coli cells that contain
additional plasmids with compatible origins."
protein_bind complement(3699..3720)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
CDS complement(3736..4815)
/label=lacI
/note="lac repressor"
promoter complement(4816..4893)
/label=lacI promoter
regulatory 4939..4955
/label=T7 promoter
/note="T7 promoter"
/regulatory_class="promoter"
This page is informational only.