pCDF-J23106-TetO-UmuD-T7RNAP-N vector (V008636)

LOCUS       40924_9411        3197 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pCDF-J23106-TetO-UmuD-T7RNAP-N, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3197)
  AUTHORS   Schaerli Y, Munteanu A, Gili M, Cotterell J, Sharpe J, Isalan M.
  TITLE     A unified design space of synthetic stripe-forming networks
  JOURNAL   Nat Commun 5, 4905 (2014)
  PUBMED    25247316
REFERENCE   2  (bases 1 to 3197)
  AUTHORS   Schaerli Y, Munteanu A, Gili M, Cotterell J, Sharpe J, Isalan M.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2014) Centre for Genomic Regulation (CRG), 
            EMBL/CRG Systems Biology Research Unit, Dr. Aiguader 88, Barcelona, 
            Barcelona 08003, Spain
REFERENCE   3  (bases 1 to 3197)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3197)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun 
            5, 4905 (2014)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-JUL-2014) Centre for Genomic Regulation (CRG), EMBL/CRG Systems 
            Biology Research Unit, Dr. Aiguader 88, Barcelona, Barcelona 08003, 
            Spain"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3197
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(117..905)
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     promoter        complement(906..997)
                     /label=AmpR promoter
     rep_origin      complement(1045..1783)
                     /direction=LEFT
                     /label=CloDF13 ori
                     /note="Plasmids containing the CloDF13 (CDF) origin of 
                     replication can be propagated in E. coli cells that contain
                     additional plasmids with compatible origins."
     primer_bind     1946..1962
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      1975..2009
                     /gene="umuD-T7 RNAP N"
                     /label=J23106 promoter
                     /note="J23106 promoter"
                     /regulatory_class="promoter"
     protein_bind    2016..2034
                     /label=tet operator
                     /note="bacterial operator O2 for the tetR and tetA genes"
     RBS             2142..2164
                     /label=RBS
                     /note="efficient ribosome binding site from bacteriophage
                     T7 gene 10 (Olins and Rangwala, 1989)"
     CDS             2172..2825
                     /codon_start=1
                     /gene="umuD-T7 RNAP N"
                     /product="UmuD-T7 RNA polymerase N"
                     /label=umuD-T7 RNAP N
                     /note="N-terminal split T7 RNAP with N-terminal degradation
                     tag (UmuD)"
                     /protein_id="AIO11017.1"
                     /translation="MLFIKPADLREIVTFPLFSDLVQCGFPSPGGGSGGGSHMNTINIA
                     KNDFSDIELAAIPFNTLADHYGERLAREQLALEHESYEMGEARFRKMFERQLKAGEVAD
                     NAAAKPLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLAC
                     LTSADNTTVQAVASAIGRAIEDEARFGRIRDLEAKHFKKNVEEQLNKRVGHVYK"
     terminator      2921..2968
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     terminator      2977..3063
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      3155..3182
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"