pZW1-snoVector vector (Cat. No.: V012196)
- Name:
- pZW1-snoVector
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4977 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Selection Marker:
- Neomycin (select with G418)
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- EGFP-Seq-5F: GACCACATGAAGCAGCACGA
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pZW1-snoVector vector (Cat. No.: V012196) Sequence
LOCUS 40924_48613 4977 bp DNA circular SYN 13-MAY-2021
DEFINITION Nuclear expression of RNAs.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4977)
AUTHORS Yin QF, Hu SB, Xu YF, Yang L, Carmichael GG, Chen LL
TITLE SnoVectors for nuclear expression of RNA.
JOURNAL Nucleic Acids Res. 2015 Jan;43(1):e5. doi: 10.1093/nar/gku1050. Epub
2014 Nov 5.
PUBMED 25378317
REFERENCE 2 (bases 1 to 4977)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4977)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res."; date: "2015-01"; pages: "
10.1093/nar/gku1050. Epub 2014 Nov 5"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4977
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 61..364
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 365..568
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
regulatory 607..616
/label=Kozak sequence
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
primer_bind complement(658..679)
/label=EGFP-N
/note="EGFP, reverse primer"
CDS complement(922..936)
/codon_start=1
/label=SNAC tag
/note="tag for protein cleavage using Ni2+ ion (Dang et
al., 2019)"
/translation="GSHHW"
primer_bind complement(1222..1241)
/label=EXFP-R
/note="For distinguishing EGFP variants, reverse primer"
primer_bind 1569..1590
/label=EGFP-C
/note="EGFP, forward primer"
polyA_signal 1765..1886
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1893..2348)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2375..2479
/label=AmpR promoter
promoter 2481..2838
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 2873..3664
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
primer_bind complement(3855..3874)
/label=TK-pA-R
/note="Thymidine kinase polyA, reverse primer"
polyA_signal 3899..3946
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 4275..4863
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"