pC35-STDCinHwt vector (V008954)

LOCUS       40924_7946       11823 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pC35-STDCinHwt, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11823)
  AUTHORS   Shao M, Blechl A, Thomson JG.
  TITLE     Small Serine Recombination Systems ParA-MRS and CinH-RS2 Perform 
            Precise Excision of Plastid DNA
  JOURNAL   Plant Biotechnol. J. (2017) In press
  PUBMED    28421718
REFERENCE   2  (bases 1 to 11823)
  AUTHORS   Shao M, Blechl A, Thomson JG.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JAN-2017) Crop Improvement and Utilization, USDA, 800 
            Buchanan Street, Albany, CA 94710, USA
REFERENCE   3  (bases 1 to 11823)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11823)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant 
            Biotechnol. J. (2017) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (04-JAN-2017) Crop Improvement and Utilization, USDA, 800 Buchanan 
            Street, Albany, CA 94710, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..11823
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(82..106)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     primer_bind     309..325
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1571..1914
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     regulatory      1933..1942
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             1939..2685
                     /codon_start=1
                     /gene="STDCinH"
                     /product="STDCinH"
                     /label=STDCinH
                     /note="site-specific recombinase CinH; originally isolated
                     from Acinetobacter sp. plasmid pKLH208B in INSD accession 
                     AJ251272; modified to include tobacco gene for ribulose 
                     1,5-bisphosphate carboxylase small subunit stroma targeting
                     domain (STD) from INSD accession X02353"
                     /protein_id="ARK38554.1"
                     /translation="MASSLLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDI
                     TSIASNGGRVQCMLINKGQKVGYVRVSSVEQNTGRQLEGIEVDRIFVDRASGKNTDRPK
                     FQEMLNYVREGDRVIVHSMDRFARSLKDLVTEVDKLVKRGIAIQFVKENITFTAQSTPM
                     DNLMLQLMGAFAQFEREIILERQKEGIKIAAAQGKYKGRVHKLNPDQAKALLQAWKEGK
                     YSSKVDLAKAFGISRQAVYRYLKQIN"
     gene            1939..2685
                     /gene="STDCinH"
                     /label=STDCinH
     sig_peptide     1939..2112
                     /gene="STDCinH"
                     /note="stroma targeting domain; STD"
     terminator      2860..3112
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(3476..3492)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    3500..3516
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3524..3554)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3569..3590)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        3781..4458
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     CDS             4527..5315
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    5375..5549
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     misc_feature    complement(5627..5651)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             6076..6867
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      6957..7545
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(7731..7871)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8215..8409)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(8478..9542)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(9979..10605)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"