Basic Vector Information
- Vector Name:
- pBR939b
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5566 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Anderson JC, Voigt CA, Arkin AP.
pBR939b vector Map
pBR939b vector Sequence
LOCUS 40924_7026 5566 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pBR939b, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5566)
AUTHORS Anderson JC, Voigt CA, Arkin AP.
TITLE Environmental signal integration by a modular AND gate
JOURNAL Mol. Syst. Biol. 3, 133 (2007)
PUBMED 17700541
REFERENCE 2 (bases 1 to 5566)
AUTHORS Salis HM, Mirsky EA, Voigt CA.
TITLE Automated design of synthetic ribosome binding sites to control
protein expression
JOURNAL Nat. Biotechnol. 27 (10), 946-950 (2009)
PUBMED 19801975
REFERENCE 3 (bases 1 to 5566)
AUTHORS Tamsir A, Tabor JJ, Voigt CA.
TITLE Robust multicellular computing using genetically encoded NOR gates
and chemical 'wires'
JOURNAL Nature 469 (7329), 212-215 (2011)
PUBMED 21150903
REFERENCE 4 (bases 1 to 5566)
AUTHORS Moser F, Voigt CA.
TITLE Genetic Circuit Performance under Conditions Relevant for Industrial
Bioreactors
JOURNAL Unpublished
REFERENCE 5 (bases 1 to 5566)
AUTHORS Anderson JC, Moser F, Tamsir A, Salis H.
TITLE Direct Submission
JOURNAL Submitted (06-JAN-2012) Biological Engineering, MIT, 500 Tech
Square, Rm 209D, Cambridge, MA 02139, USA
REFERENCE 6 (bases 1 to 5566)
TITLE Direct Submission
REFERENCE 7 (bases 1 to 5566)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Syst.
Biol. 3, 133 (2007)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Nat.
Biotechnol."; date: "2009"; volume: "27"; issue: "10"; pages:
"946-950"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Nature";
date: "2011"; volume: "469"; issue: "7329"; pages: "212-215"
COMMENT SGRef: number: 4; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 5; type: "Journal Article"; journalName: "Submitted
(06-JAN-2012) Biological Engineering, MIT, 500 Tech Square, Rm 209D,
Cambridge, MA 02139, USA"
COMMENT SGRef: number: 6; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5566
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 211..229
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 296..1009
/codon_start=1
/label=GFP (S65T)
/note="S65T variant of Aequorea victoria green fluorescent
protein (Heim et al., 1995)"
/translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
FVTAAGITHGMDELYK"
terminator 1074..1168
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
CDS 1225..1254
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 1270..1287
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 1513..1559
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
promoter 1685..1789
/label=AmpR promoter
CDS 1790..2647
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
rep_origin 2820..3408
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(3594..3734)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(3839..4027)
/codon_start=1
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
This page is informational only.