pBISN1-IN vector (V009178)

LOCUS       40924_6556       13144 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Transformation vector pBISN1-IN, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13144)
  AUTHORS   Abdeeva IA, Abdeev RM, Piruzian ES.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2008) Laboratory of Functional Genomics, Vavilov's
            Institute of General Genetics Russian Academy of Science, Gubkina, 
            Moscow 119991, Russia
REFERENCE   2  (bases 1 to 13144)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 13144)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (15-JUL-2008) Laboratory of Functional Genomics, Vavilov's Institute
            of General Genetics Russian Academy of Science, Gubkina, Moscow 
            119991, Russia"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13144
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      6..616
                     /label=oriV
                     /note="origin of replication for the bacterial F plasmid"
     mobile_element  complement(1317..2084)
                     /label=IS1
                     /note="prokaryotic transposable element"
     CDS             2276..3067
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             3369..4514
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"
     misc_feature    6113..6137
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     primer_bind     6755..6771
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      complement(6773..6977)
                     /regulatory_class="polyA_signal_sequence"
     CDS             complement(7000..7659)
                     /codon_start=1
                     /gene="licBM2"
                     /product="lichenase"
                     /label=licBM2
                     /note="beta-1,3-1,4-glucanase"
                     /protein_id="ACI16381.1"
                     /translation="MVNTPFVAVFSNFDSSQWEKADWANGSVFNCVWKPSQVTFSNGKM
                     ILTLDREYGGSYPYKSGEYRTKSFFGYGYYEVRMKAAKNVGIVSSFFTYTGPSDNNPWD
                     EIDIEFLGKDTTKVQFNWYKNGVGGNEYLHNLGFDASQDFHTYGFEWRPDYIDFYVDGK
                     KVYRGTRNIPVTPGKIMMNLWPGIGVDEWLGRYDGRTPLQAEYEYVKYYPNGKDEL"
     gene            complement(7000..7659)
                     /gene="licBM2"
                     /label=licBM2
     sig_peptide     complement(7003..7014)
                     /gene="licBM2"
                     /note="signal peptide KDEL tailed"
     misc_feature    complement(7662..7732)
                     /label=leader signal of the Vicia faba leB4
                     /note="leader signal of the Vicia faba leB4"
     promoter        complement(7738..8082)
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     primer_bind     complement(8209..8225)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8233..8249
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8257..8287)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8302..8323)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     terminator      complement(8871..9123)
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     rep_origin      9998..10624
                     /label=oriV
                     /note="incP origin of replication"
     misc_feature    10667..10691
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             11156..11803
                     /label=TetR
                     /note="tetracycline resistance regulatory protein"
     oriT            12487..12596
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             12629..12997
                     /label=traJ
                     /note="oriT-recognizing protein"