Basic Vector Information
p34S-Tp vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
p34S-Tp vector Sequence
LOCUS 40924_2607 3394 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector p34S-Tp, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3394)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Plasposons: modular self-cloning minitransposon derivatives for
rapid genetic analysis of gram-negative bacterial genomes
JOURNAL Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998)
PUBMED 9647854
REFERENCE 2 (bases 1 to 3394)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Direct Submission
JOURNAL Submitted (30-APR-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley
Rd., New Brunswick, NJ 08901-8520, USA
REFERENCE 3 (bases 1 to 3394)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3394)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages:
"2710-2715"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-APR-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley
Rd., New Brunswick, NJ 08901-8520, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3394
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..51
/label=cassette multiple cloning site
/note="cassette multiple cloning site"
promoter 64..92
/label=Pc promoter
/note="class 1 integron promoter"
CDS 419..652
/codon_start=1
/label=TpR
/note="E. coli plasmid-associated dihydrofolate reductase"
/translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
misc_feature 658..708
/label=cassette multiple cloning site
/note="cassette multiple cloning site"
promoter complement(714..732)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(751..767)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(775..791)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(799..829)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(844..865)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1153..1741)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1915..2772)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(2773..2877)
/label=AmpR promoter
primer_bind 3351..3367
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3370..3388
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.