Basic Vector Information
- Vector Name:
- p34S-Gm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3617 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dennis JJ, Zylstra GJ.
- Promoter:
- Pc
p34S-Gm vector Map
p34S-Gm vector Sequence
LOCUS 40924_2582 3617 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector p34S-Gm, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3617)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Plasposons: modular self-cloning minitransposon derivatives for
rapid genetic analysis of gram-negative bacterial genomes
JOURNAL Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998)
PUBMED 9647854
REFERENCE 2 (bases 1 to 3617)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Direct Submission
JOURNAL Submitted (30-APR-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley
Rd., New Brunswick, NJ 08901-8520, USA
REFERENCE 3 (bases 1 to 3617)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3617)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages:
"2710-2715"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(30-APR-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley
Rd., New Brunswick, NJ 08901-8520, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3617
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(1..57)
/label=MCS
/note="pUC18/19 multiple cloning site"
promoter 55..83
/label=Pc promoter
/note="class 1 integron promoter"
CDS 272..802
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
misc_feature 875..931
/label=MCS
/note="pUC18/19 multiple cloning site"
promoter complement(937..955)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(974..990)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(998..1014)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1022..1052)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1067..1088)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1376..1964)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2138..2995)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(2996..3100)
/label=AmpR promoter
primer_bind 3574..3590
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3593..3611
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.