Cart 2

PA-mCherry1-C1 vector (V009804#)

Basic Vector Information

Basic Vector Information
Vector Name PA-mCherry1-C1 Antibiotic Resistance Kanamycin
Length 4716 bp Type Mammalian Expression
Selection Marker Neomycin (select with G418) Copy Number High Copy

PA-mCherry1-C1 vector Vector Map

CMV enhancer CMV promoter Kozak sequence MCS SV40 poly(A) signal f1 ori AmpR promoter SV40 promoter NeoR/KanR TK-pA-R HSV TK poly(A) signal ori

Plasmid Resuspension protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

PA-mCherry1-C1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4716 bp ds-DNA     circular SYN 13-MAY-2021
DEFINITION  Localization: C1 Cloning Vector, Excitation: 400 / 504, Emission: 
            515 / 517.
ACCESSION   .
VERSION     .
KEYWORDS    PA-mCherry1-C1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4716)
  TITLE     Michael Davidson Empty Backbones
REFERENCE   2  (bases 1 to 4716)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4716
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        115..418
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        419..622
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     primer_bind     573..593
                     /label=CMV-F
                     /note="Human CMV immediate early promoter, forward primer"
     regulatory      655..664
                     /regulatory_class="other"
                     /label=Kozak sequence
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             661..1368
                     /codon_start=1
                     /product="photoactivatable monomeric derivative of DsRed 
                     fluorescent protein (Subach et al., 2009)"
                     /label=PAmCherry1
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHVFEIEGEGEGRPYEG
                     TQTAKLKVTKGGPLPFTWDILSPQFMYGSNAYVKHPADIPDYFKLSFPEGFKWERVMKF
                     EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEALSERMYPEDGALK
                     GEVKPRVKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERA
                     EGRHSTGGMDELYK"
     primer_bind     complement(806..824)
                     /label=mCherry-R
                     /note="mCherry, reverse primer"
     misc_feature    1369..1434
                     /label=MCS
                     /note="multiple cloning site"
     polyA_signal    1558..1679
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(1595..1614)
                     /label=SV40pA-R
                     /note="SV40 polyA, reverse primer"
     primer_bind     1649..1668
                     /label=EBV-rev
                     /note="SV40 polyA terminator, reverse primer"
     rep_origin      complement(1686..2141)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(1823..1844)
                     /label=F1ori-F
                     /note="F1 origin, forward primer"
     primer_bind     2035..2054
                     /label=F1ori-R
                     /note="F1 origin, reverse primer"
     promoter        2168..2272
                     /gene="bla"
                     /label=AmpR promoter
     promoter        2274..2631
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     primer_bind     complement(2297..2317)
                     /label=pBABE 3'
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     rep_origin      2482..2617
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     primer_bind     2544..2563
                     /label=SV40pro-F
                     /note="SV40 promoter/origin, forward primer"
     CDS             2666..3460
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(2720..2739)
                     /label=Neo-R
                     /note="Neomycin resistance gene, reverse primer"
     primer_bind     3330..3349
                     /label=Neo-F
                     /note="Neomycin resistance gene, forward primer"
     primer_bind     complement(3648..3667)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    3692..3739
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      4068..4656
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     4557..4576
                     /label=pBR322ori-F
                     /note="pBR322 origin, forward primer"

This page is informational only.