p-REX2mDHFR-int vector (V009810)

LOCUS       V009810                 8685 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V009810
VERSION     V009810
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 8685)
  AUTHORS   Mesen-Ramirez P, Reinsch F, Blancke Soares A, Bergmann B, Ullrich
            AK, Tenzer S, Spielmann T.
  TITLE     Stable Translocation Intermediates Jam Global Protein Export in
            Plasmodium falciparum Parasites and Link the PTEX Component EXP2
            with Translocation Activity
  JOURNAL   PLoS Pathog. 12 (5), E1005618 (2016)
   PUBMED   27168322
REFERENCE   2  (bases 1 to 8685)
  AUTHORS   Blancke Soares A, Spielmann T.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-2016) Parasitology Section, Bernhard Nocht
            Institute for Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg
            20359, Germany
REFERENCE   3  (bases 1 to 8685)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8685)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS
            Pathog."; date: "2016"; volume: "12"; issue: "5"; pages: "E1005618"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (29-MAR-2016) Parasitology Section, Bernhard Nocht Institute for
            Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg 20359, Germany"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8685
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      36..1499
                     /label="Pfcrt 5' region"
                     /note="Pfcrt 5' region"
                     /regulatory_class="promoter"
     misc_feature    1506..1787
                     /note="similar to REX2; P. falciparum ring exported protein
                     2 (PF3D7_0936000)"
     misc_feature    1794..2354
                     /note="similar to mDHFR; mouse dihydrofolate reductase"
     CDS             1794..2354
                     /codon_start=1
                     /gene="Mus musculus Dhfr"
                     /product="mouse dihydrofolate reductase"
                     /label="DHFR"
                     /translation="MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVE
                     GKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQP
                     ELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEY
                     PGVLSEVQEEKGIKYKFEVYEKKD"
     CDS             2361..3074
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     regulatory      3089..3541
                     /label="P. berghei DT 3' region"
                     /note="P. berghei DT 3' region"
                     /regulatory_class="terminator"
     regulatory      complement(3553..3898)
                     /label="PfHOP 5' region"
                     /note="PfHOP 5' region"
                     /regulatory_class="promoter"
     regulatory      3899..4389
                     /label="PfCAM 5' region"
                     /note="PfCAM 5' region"
                     /regulatory_class="promoter"
     CDS             4396..4956
                     /gene="DHFR"
                     /label="Dihydrofolate reductase"
                     /note="Dihydrofolate reductase from Homo sapiens.
                     Accession#: P00374"
     CDS             4966..5019
                     /label="T2A"
                     /note="2A peptide from Thosea asigna virus capsid protein"
     CDS             5026..5421
                     /label="BSD"
                     /note="blasticidin S deaminase"
     regulatory      5429..5998
                     /label="PfhrpII 3' region"
                     /note="PfhrpII 3' region"
                     /regulatory_class="terminator"
     promoter        complement(6003..6020)
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(6027..6043)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        6517..6621
                     /label="AmpR promoter"
     CDS             6622..7479
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      7653..8241
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    8529..8550
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        8565..8595
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    8603..8619
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     8627..8643
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        8661..8679
                     /label="SP6 promoter"
                     /note="promoter for bacteriophage SP6 RNA polymerase"