Basic Vector Information
- Vector Name:
- p-REX2mDHFR-int
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8685 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Mesen-Ramirez P, Reinsch F, Blancke Soares A, Bergmann B, Ullrich AK, Tenzer S, Spielmann T.
- Promoter:
- SP6
p-REX2mDHFR-int vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
p-REX2mDHFR-int vector Sequence
LOCUS 40924_2333 8685 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector p-REX2mDHFR-int, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8685)
AUTHORS Mesen-Ramirez P, Reinsch F, Blancke Soares A, Bergmann B, Ullrich
AK, Tenzer S, Spielmann T.
TITLE Stable Translocation Intermediates Jam Global Protein Export in
Plasmodium falciparum Parasites and Link the PTEX Component EXP2
with Translocation Activity
JOURNAL PLoS Pathog. 12 (5), E1005618 (2016)
PUBMED 27168322
REFERENCE 2 (bases 1 to 8685)
AUTHORS Blancke Soares A, Spielmann T.
TITLE Direct Submission
JOURNAL Submitted (29-MAR-2016) Parasitology Section, Bernhard Nocht
Institute for Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg
20359, Germany
REFERENCE 3 (bases 1 to 8685)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8685)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS
Pathog."; date: "2016"; volume: "12"; issue: "5"; pages: "E1005618"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-MAR-2016) Parasitology Section, Bernhard Nocht Institute for
Tropical Medicine, Bernhard-Nocht-Str. 74, Hamburg 20359, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8685
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 36..1499
/label=Pfcrt 5' region
/note="Pfcrt 5' region"
/regulatory_class="promoter"
misc_feature 1506..1787
/note="similar to REX2; P. falciparum ring exported protein
2 (PF3D7_0936000)"
misc_feature 1794..2354
/note="similar to mDHFR; mouse dihydrofolate reductase"
CDS 1794..2354
/codon_start=1
/gene="Mus musculus Dhfr"
/product="mouse dihydrofolate reductase"
/label=DHFR
/translation="MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVE
GKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQP
ELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEY
PGVLSEVQEEKGIKYKFEVYEKKD"
CDS 2361..3074
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
regulatory 3089..3541
/label=P. berghei DT 3' region
/note="P. berghei DT 3' region"
/regulatory_class="terminator"
regulatory complement(3553..3898)
/label=PfHOP 5' region
/note="PfHOP 5' region"
/regulatory_class="promoter"
regulatory 3899..4389
/label=PfCAM 5' region
/note="PfCAM 5' region"
/regulatory_class="promoter"
CDS 4396..4956
/gene="DHFR"
/label=DHFR
/note="Dihydrofolate reductase from Homo sapiens.
Accession#: P00374"
CDS 4966..5019
/label=T2A
/note="2A peptide from Thosea asigna virus capsid protein"
CDS 5026..5421
/label=BSD
/note="blasticidin S deaminase"
regulatory 5429..5998
/label=PfhrpII 3' region
/note="PfhrpII 3' region"
/regulatory_class="terminator"
promoter complement(6003..6020)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(6027..6043)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 6517..6621
/label=AmpR promoter
CDS 6622..7479
/label=AmpR
/note="beta-lactamase"
rep_origin 7653..8241
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 8529..8550
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 8565..8595
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 8603..8619
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 8627..8643
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 8661..8679
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.