OpiE2-iFlp-Ieterm vector (V009821)

Basic Vector Information

      • Vector Name:
      • OpiE2-iFlp-Ieterm
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 4413 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Vidigal J, Teixeira AP.

OpiE2-iFlp-Ieterm vector Vector Map

OpiE2-iFlp-Ieterm4413 bp600120018002400300036004200OpIE-2 promoterFLPoIE1 terminatororiISSAmpR promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

OpiE2-iFlp-Ieterm vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_2284        4413 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector OpiE2-iFlp-Ieterm, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4413)
  AUTHORS   Vidigal J, Teixeira AP.
  TITLE     RMCE-based insect cell platform to produce membrane proteins 
            captured on HIV-1 Gag virus-like particles
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4413)
  AUTHORS   van den Heuvel JJ, Bleckmann M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2017) Structure and Function of Proteins, 
            Helmholtz Centre for Infection Research, Inhoffenstrasse 7, 
            Braunschweig, Lower Saxony 38124, Germany
REFERENCE   3  (bases 1 to 4413)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4413)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (05-OCT-2017) Structure and Function of Proteins, Helmholtz Centre 
            for Infection Research, Inhoffenstrasse 7, Braunschweig, Lower 
            Saxony 38124, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: VectorNTI v. 8
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4413
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        22..569
                     /label=OpIE-2 promoter
                     /note="strong constitutive baculovirus promoter for insect
                     cell expression"
     CDS             582..1877
                     /codon_start=1
                     /label=FLPo
                     /note="nuclear-targeted site-specific recombinase"
                     /translation="MAPKKKRKVMPQFGILCKTPPKVLVRQFVERFERPSGEKIASCAA
                     ELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKK
                     LIPAWEFTIIPYYGQKHQSDITDIVSRLQLQFESSEEADKGNSRSKKMLKALLSEGESI
                     WEITEKILNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV
                     IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEY
                     QLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWS
                     DKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQL
                     KGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI"
     terminator      1893..2199
                     /label=IE1 terminator
                     /note="terminator of the ie1 gene from the baculovirus 
                     Autographa californica"
     rep_origin      complement(2553..3141)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(3608..3986)
                     /label=ISS
                     /note="immunostimulatory sequence from the AmpR gene;
                     contains unmethylated CpG dinucleotides in the context of 
                     5'-AACGTT-3' (Sato et al., 1996)"
     promoter        complement(4171..4275)
                     /label=AmpR promoter

This page is informational only.