Basic Vector Information
- Vector Name:
- OpiE2-iFlp-Ieterm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4413 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vidigal J, Teixeira AP.
- Promoter:
- OpIE-2
OpiE2-iFlp-Ieterm vector Map
OpiE2-iFlp-Ieterm vector Sequence
LOCUS 40924_2284 4413 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector OpiE2-iFlp-Ieterm, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4413)
AUTHORS Vidigal J, Teixeira AP.
TITLE RMCE-based insect cell platform to produce membrane proteins
captured on HIV-1 Gag virus-like particles
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 4413)
AUTHORS van den Heuvel JJ, Bleckmann M.
TITLE Direct Submission
JOURNAL Submitted (05-OCT-2017) Structure and Function of Proteins,
Helmholtz Centre for Infection Research, Inhoffenstrasse 7,
Braunschweig, Lower Saxony 38124, Germany
REFERENCE 3 (bases 1 to 4413)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4413)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(05-OCT-2017) Structure and Function of Proteins, Helmholtz Centre
for Infection Research, Inhoffenstrasse 7, Braunschweig, Lower
Saxony 38124, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: VectorNTI v. 8
Sequencing Technology :: 454
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..4413
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 22..569
/label=OpIE-2 promoter
/note="strong constitutive baculovirus promoter for insect
cell expression"
CDS 582..1877
/codon_start=1
/label=FLPo
/note="nuclear-targeted site-specific recombinase"
/translation="MAPKKKRKVMPQFGILCKTPPKVLVRQFVERFERPSGEKIASCAA
ELTYLCWMITHNGTAIKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKK
LIPAWEFTIIPYYGQKHQSDITDIVSRLQLQFESSEEADKGNSRSKKMLKALLSEGESI
WEITEKILNSFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV
IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEY
QLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNWS
DKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPIEEWQHIEQL
KGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI"
terminator 1893..2199
/label=IE1 terminator
/note="terminator of the ie1 gene from the baculovirus
Autographa californica"
rep_origin complement(2553..3141)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(3608..3986)
/label=ISS
/note="immunostimulatory sequence from the AmpR gene;
contains unmethylated CpG dinucleotides in the context of
5'-AACGTT-3' (Sato et al., 1996)"
promoter complement(4171..4275)
/label=AmpR promoter
This page is informational only.