Cart 2

mini-CTX-GFP vector (V009851#)

Basic Vector Information

Basic Vector Information
Vector Name mini-CTX-GFP Antibiotic Resistance Tetracycline
Length 6370 bp Type Integration vector
Source Hoang TT, Kutchma AJ, Becher A, Schweizer HP.

mini-CTX-GFP vector Vector Map

Flp recombinase binding site phage CTX attachment site, core sequence T4 transcription termination signal T3 promoter SK primer GFP KS primer T7 promoter T4 transcription termination signal Flp recombinase binding site int ori tet

mini-CTX-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6370 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Integration vector mini-CTX-GFP, complete sequence.
ACCESSION   AF140578
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6370)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     A site-specific gene integration system for Pseudomonas aeruginosa
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6370)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-1999) Microbiology, Colorado State University, 
            Fort Collins, CO 80523, USA
REFERENCE   3  (bases 1 to 6370)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6370
                     /organism="Integration vector mini-CTX-GFP"
                     /lab_host="Pseudomonas aeruginosa"
                     /mol_type="other DNA"
                     /db_xref="taxon:106408"
     protein_bind    238..285
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
                     /note="Flp recombinase target site"
     misc_feature    495..521
                     /label=phage CTX attachment site, core sequence
                     /note="phage CTX attachment site, core sequence"
     regulatory      745..769
                     /regulatory_class="terminator"
                     /note="T4 transcription termination signal"
     regulatory      827..846
                     /regulatory_class="promoter"
                     /note="T3 promoter"
     promoter        827..845
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     882..898
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(908..1624)
                     /codon_start=1
                     /gene="GFP"
                     /product="green fluorescent protein"
                     /label=GFP
                     /protein_id="AAF06117.1"
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
     gene            complement(908..1624)
                     /gene="GFP"
                     /label=GFP
                     /note="GFP mut2 variant"
     primer_bind     complement(1692..1708)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      1733..1752
                     /regulatory_class="promoter"
                     /note="T7 promoter"
     promoter        complement(1734..1752)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      1811..1835
                     /regulatory_class="terminator"
                     /note="T4 transcription termination signal"
     protein_bind    1926..1973
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
                     /note="Flp recombinase target site"
     oriT            2173..2432
     oriT            2180..2288
                     /note="incP origin of transfer"
     CDS             complement(2447..3616)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /label=int
                     /protein_id="AAF06118.1"
                     /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI
                     INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR
                     PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD
                     GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD
                     LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR
                     DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM
                     LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS"
     gene            complement(2447..3616)
                     /gene="int"
                     /label=int
                     /note="modified phage CTX integrase gene"
     rep_origin      complement(3713..4301)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5123..6313)
                     /codon_start=1
                     /gene="tet"
                     /product="Tet protein"
                     /label=tet
                     /protein_id="AAF06119.1"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     gene            complement(5123..6313)
                     /gene="tet"
                     /label=tet
                     /note="modified tet gene"
     promoter        complement(6361..19)
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"

This page is informational only.