Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | mini-CTX-GFP | Antibiotic Resistance | Tetracycline |
Length | 6370 bp | Type | Integration vector |
Source | Hoang TT, Kutchma AJ, Becher A, Schweizer HP. |
mini-CTX-GFP vector Vector Map
Plasmid Resuspension protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
mini-CTX-GFP vector Sequence
LOCUS Exported 6370 bp ds-DNA circular SYN 17-DEC-2018 DEFINITION Integration vector mini-CTX-GFP, complete sequence. ACCESSION AF140578 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6370) AUTHORS Hoang TT, Kutchma AJ, Becher A, Schweizer HP. TITLE A site-specific gene integration system for Pseudomonas aeruginosa JOURNAL Unpublished REFERENCE 2 (bases 1 to 6370) AUTHORS Hoang TT, Kutchma AJ, Becher A, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (06-APR-1999) Microbiology, Colorado State University, Fort Collins, CO 80523, USA REFERENCE 3 (bases 1 to 6370) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..6370 /organism="Integration vector mini-CTX-GFP" /lab_host="Pseudomonas aeruginosa" /mol_type="other DNA" /db_xref="taxon:106408" protein_bind 238..285 /label=Flp recombinase binding site /bound_moiety="Flp recombinase" /note="Flp recombinase target site" misc_feature 495..521 /label=phage CTX attachment site, core sequence /note="phage CTX attachment site, core sequence" regulatory 745..769 /regulatory_class="terminator" /note="T4 transcription termination signal" regulatory 827..846 /regulatory_class="promoter" /note="T3 promoter" promoter 827..845 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind 882..898 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS complement(908..1624) /codon_start=1 /gene="GFP" /product="green fluorescent protein" /label=GFP /protein_id="AAF06117.1" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" gene complement(908..1624) /gene="GFP" /label=GFP /note="GFP mut2 variant" primer_bind complement(1692..1708) /label=KS primer /note="common sequencing primer, one of multiple similar variants" regulatory 1733..1752 /regulatory_class="promoter" /note="T7 promoter" promoter complement(1734..1752) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" regulatory 1811..1835 /regulatory_class="terminator" /note="T4 transcription termination signal" protein_bind 1926..1973 /label=Flp recombinase binding site /bound_moiety="Flp recombinase" /note="Flp recombinase target site" oriT 2173..2432 oriT 2180..2288 /note="incP origin of transfer" CDS complement(2447..3616) /codon_start=1 /gene="int" /product="integrase" /label=int /protein_id="AAF06118.1" /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS" gene complement(2447..3616) /gene="int" /label=int /note="modified phage CTX integrase gene" rep_origin complement(3713..4301) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5123..6313) /codon_start=1 /gene="tet" /product="Tet protein" /label=tet /protein_id="AAF06119.1" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" gene complement(5123..6313) /gene="tet" /label=tet /note="modified tet gene" promoter complement(6361..19) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene"
This page is informational only.