Cart 2

LUCTRAP vector (V009853#)

Basic Vector Information

Basic Vector Information
Vector Name LUCTRAP Length 5990 bp
Type Cloning vector Source Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C.

LUCTRAP vector Vector Map

NPT1 ori T-DNA right border multiple cloning site 35S CaMV terminator KS primer T7 promoter M13 fwd NOS promoter APH NOS terminator T-DNA left border

LUCTRAP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5990 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector LUCTRAP, complete sequence.
ACCESSION   DQ073044
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5990)
  AUTHORS   Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, 
            Schwechheimer C.
  TITLE     LucTrap vectors are tools to generate luciferase fusions for the 
            quantification of transcript and protein abundance in vivo
  JOURNAL   Plant Physiol. 141 (1), 3-14 (2006)
  PUBMED    16684932
REFERENCE   2  (bases 1 to 5990)
  AUTHORS   Calderon LIA. V, Kuhnle C, Dohmann EMN., Li H, Schwechheimer C.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2005) Developmental Genetics, Centre for Plant 
            Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 5990)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5990
                     /organism="Cloning vector LUCTRAP"
                     /mol_type="other DNA"
                     /db_xref="taxon:337211"
     CDS             320..1135
                     /codon_start=1
                     /gene="NPT1"
                     /product="NPT1"
                     /label=NPT1
                     /protein_id="AAZ23211.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            320..1135
                     /gene="NPT1"
                     /label=NPT1
     rep_origin      1236..1824
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1915..1939
                     /label=T-DNA right border
                     /note="T-DNA right border"
     misc_feature    1940..1973
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             1970..3622
                     /codon_start=1
                     /product="modified luciferase protein"
                     /label=modified luciferase protein
                     /protein_id="AAZ23212.1"
                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA
                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP
                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS
                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA
                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK
                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY
                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS
                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL
                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV
                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     regulatory      3638..3757
                     /regulatory_class="terminator"
                     /note="35S CaMV terminator"
     primer_bind     complement(3777..3793)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(3819..3837)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3844..3860)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4035..4307
                     /regulatory_class="promoter"
                     /note="NOS promoter"
     promoter        4107..4286
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             4320..5114
                     /codon_start=1
                     /product="APH(3')-IIA"
                     /label=APH
                     /note="resistance protein"
                     /protein_id="AAZ23213.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     regulatory      5149..5408
                     /regulatory_class="terminator"
                     /note="NOS terminator"
     terminator      5154..5405
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    5428..5452
                     /label=T-DNA left border
                     /note="T-DNA left border"
     misc_feature    5429..5451
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA 
                     (truncated)"
     rep_origin      5468..30
                     /label=Rep ori pSA
                     /note="Rep ori pSA"
     rep_origin      5584..29
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"

This page is informational only.