Cart 2

LUCTRAP-3(GW) vector (V009854#)

Basic Vector Information

Basic Vector Information
Vector Name LUCTRAP-3(GW) Length 7272 bp
Type Cloning vector Source Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C.

LUCTRAP-3(GW) vector Vector Map

Npt1 ori T-DNA right border gateway cassette modified luciferase 35S CaMV terminator KS primer T7 promoter M13 fwd NOS promoter APH NOS terminator LB T-DNA repeat

LUCTRAP-3(GW) vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                7272 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector LUCTRAP-3(GW), complete sequence.
ACCESSION   AY968054
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7272)
  AUTHORS   Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, 
            Schwechheimer C.
  TITLE     LucTrap vectors are tools to generate luciferase fusions for the 
            quantification of transcript and protein abundance in vivo
  JOURNAL   Plant Physiol. 141 (1), 3-14 (2006)
  PUBMED    16684932
REFERENCE   2  (bases 1 to 7272)
  AUTHORS   Calderon LIA. V, Kuhnle C, Dohmann EMN., Li H, Schwechheimer C.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAR-2005) Developmental Genetics, Centre for Plant 
            Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 7272)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..7272
                     /organism="Cloning vector LUCTRAP-3(GW)"
                     /mol_type="other DNA"
                     /db_xref="taxon:328298"
     rep_origin      1..30
     CDS             320..1135
                     /codon_start=1
                     /product="Npt1"
                     /label=Npt1
                     /note="resistance protein; derived from Escherichia coli"
                     /protein_id="AAY33851.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      1236..1824
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1915..1939
                     /label=T-DNA right border
                     /note="T-DNA right border"
     misc_feature    1940..3251
                     /label=gateway cassette
                     /note="gateway cassette"
     protein_bind    1950..2074
                     /gene="mutant version of attR"
                     /label=attR1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        2099..2129
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an ""up"" mutation"
     CDS             2777..3082
                     /codon_start=1
                     /gene="ccdB"
                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /label=ccdB
                     /note="Plasmids containing the ccdB gene cannot be 
                     propagated in standard E. coli strains."
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     protein_bind    complement(3123..3247)
                     /gene="mutant version of attR"
                     /label=attR2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             3252..4904
                     /codon_start=1
                     /product="modified luciferase"
                     /label=modified luciferase
                     /note="LUC+"
                     /protein_id="AAY33852.1"
                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA
                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP
                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS
                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA
                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK
                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY
                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS
                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL
                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV
                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     regulatory      4920..5039
                     /regulatory_class="terminator"
                     /note="35S CaMV terminator"
     primer_bind     complement(5059..5075)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(5101..5119)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(5126..5142)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      5317..5589
                     /regulatory_class="promoter"
                     /note="NOS promoter"
     promoter        5389..5568
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             5602..6396
                     /codon_start=1
                     /product="APH(3')-IIA"
                     /label=APH
                     /note="resistance protein"
                     /protein_id="AAY33853.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     terminator      6436..6687
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     regulatory      6616..6689
                     /regulatory_class="terminator"
                     /note="NOS terminator"
     misc_feature    6711..6733
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA 
                     (truncated)"
     misc_feature    6717..6733
                     /label=T-DNA left border
                     /note="T-DNA left border"
     rep_origin      6752..7247
     rep_origin      6866..29
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"

This page is informational only.