Basic Vector Information
- Vector Name:
- LIC-pPICZ-LC2
- Antibiotic Resistance:
- Bleomycin
- Length:
- 4938 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Dortay H, Akula UM, Westphal C, Sittig M, Mueller-Roeber B.
- Promoter:
- AOX1
LIC-pPICZ-LC2 vector Map
LIC-pPICZ-LC2 vector Sequence
LOCUS 40924_1794 4938 bp DNA circular SYN 17-DEC-2018
DEFINITION Expression vector LIC-pPICZ-LC2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4938)
AUTHORS Dortay H, Akula UM, Westphal C, Sittig M, Mueller-Roeber B.
TITLE High-Throughput Protein Expression Using a Combination of
Ligation-Independent Cloning (LIC) and Infrared Fluorescent Protein
(IFP) Detection
JOURNAL PLoS ONE 6 (4), E18900 (2011)
PUBMED 21541323
REFERENCE 2 (bases 1 to 4938)
AUTHORS Dortay H, Mueller-Roeber B.
TITLE Direct Submission
JOURNAL Submitted (14-FEB-2011) Molecular Biology, University of Potsdam,
Germany, Karl-Liebknecht-Str. 24-25, Haus 20, Potsdam, Brandenburg
14476, Germany
REFERENCE 3 (bases 1 to 4938)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4938)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2011"; volume: "6"; issue: "4"; pages: "E18900"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(14-FEB-2011) Molecular Biology, University of Potsdam, Germany,
Karl-Liebknecht-Str. 24-25, Haus 20, Potsdam, Brandenburg 14476,
Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4938
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..935
/label=AOX1 promoter
/note="inducible promoter, regulated by methanol"
misc_feature 945..947
/label=start codon
/note="start codon"
misc_feature 957..964
/label=PmeI recognition site
/note="PmeI recognition site"
misc_feature 965..1631
/label=LIC stuffer fragment
/note="LIC stuffer fragment"
misc_feature 1632..1639
/label=PmeI recognition site
/note="PmeI recognition site"
CDS 1645..1665
/codon_start=1
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
/translation="ENLYFQG"
CDS 1675..2658
/codon_start=1
/label=IFP1.4
/note="bacteriophytochrome-based monomeric infrared
fluorescent protein (Shu et al., 2009)"
/translation="MARDPLPFFPPLYLGGPEITTENCEREPIHIPGSIQPHGALLTAD
GHSGEVLQVSLNAATFLGQEPTVLRGQTLAALLPEQWPALQAALPPGCPDALQYRATLD
WPAAGHLSLTVHRVAELLILEFEPTEAWDSIGPHALRNAMFALESAPNLRALAEVATQT
VRELTGFDRVMLYKFAPDATGEMIAEARREGMQAFLGHRFPASHTPAQARALYTRHLLR
LTADTRAAAVPLDPVLNPQTNAPTPLGGAVLRATSPMHMQYLRNMGVGSSLSVSVVVGG
QLWGLIVCHHQTPYVLPPDLRTTLEELGRKLSGQVQRKEAGMDELYK"
CDS 2665..2682
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
misc_feature 2683..2685
/label=stop codon (TGA)
/note="stop codon (TGA)"
terminator 2762..3008
/label=AOX1 terminator
/note="transcription terminator for AOX1"
promoter 3023..3434
/label=TEF1 promoter
/note="promoter for EF-1-alpha"
promoter 3442..3489
/label=EM7 promoter
/note="synthetic bacterial promoter"
CDS 3508..3879
/codon_start=1
/label=BleoR
/note="antibiotic-binding protein"
/translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
EFALRDPAGNCVHFVAEEQD"
terminator 3948..4195
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(4270..4858)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.