NovoPro
Cart 2

LIC-pPICZ-LC1 vector

Basic Vector Information

Basic Vector Information
Vector Name LIC-pPICZ-LC1 Length 4982 bp
Type Expression vector Source Dortay H, Akula UM, Westphal C, Sittig M, Mueller-Roeber B.

LIC-pPICZ-LC1 vector Vector Map

LIC-pPICZ-LC1 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                4982 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector LIC-pPICZ-LC1, complete sequence.
ACCESSION   JF327850
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4982)
  AUTHORS   Dortay H, Akula UM, Westphal C, Sittig M, Mueller-Roeber B.
  TITLE     High-Throughput Protein Expression Using a Combination of 
            Ligation-Independent Cloning (LIC) and Infrared Fluorescent Protein 
            (IFP) Detection
  JOURNAL   PLoS ONE 6 (4), E18900 (2011)
  PUBMED    21541323
REFERENCE   2  (bases 1 to 4982)
  AUTHORS   Dortay H, Mueller-Roeber B.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-FEB-2011) Molecular Biology, University of Potsdam, 
            Germany, Karl-Liebknecht-Str. 24-25, Haus 20, Potsdam, Brandenburg 
            14476, Germany
REFERENCE   3  (bases 1 to 4982)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..4982
                     /organism="Expression vector LIC-pPICZ-LC1"
                     /mol_type="other DNA"
                     /label=Pichia pastoris expression vector
                     /note="Pichia pastoris expression vector"
                     /db_xref="taxon:1029643"
     regulatory      1..944
                     /regulatory_class="promoter"
                     /note="5' promoter region"
     misc_feature    945..947
                     /label=start codon
                     /note="start codon"
     misc_feature    957..974
                     /label=6xHis tag
                     /note="6xHis tag"
     CDS             957..974
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     misc_feature    984..1967
                     /label=infrared fluorescent protein
                     /note="infrared fluorescent protein"
     CDS             984..1967
                     /codon_start=1
                     /product="bacteriophytochrome-based monomeric infrared 
                     fluorescent protein (Shu et al., 2009)"
                     /label=IFP1.4
                     /translation="MARDPLPFFPPLYLGGPEITTENCEREPIHIPGSIQPHGALLTAD
                     GHSGEVLQVSLNAATFLGQEPTVLRGQTLAALLPEQWPALQAALPPGCPDALQYRATLD
                     WPAAGHLSLTVHRVAELLILEFEPTEAWDSIGPHALRNAMFALESAPNLRALAEVATQT
                     VRELTGFDRVMLYKFAPDATGEMIAEARREGMQAFLGHRFPASHTPAQARALYTRHLLR
                     LTADTRAAAVPLDPVLNPQTNAPTPLGGAVLRATSPMHMQYLRNMGVGSSLSVSVVVGG
                     QLWGLIVCHHQTPYVLPPDLRTTLEELGRKLSGQVQRKEAGMDELYK"
     misc_feature    1968..1988
                     /label=TEV recognition site
                     /note="TEV recognition site"
     CDS             1968..1988
                     /codon_start=1
                     /product="tobacco etch virus (TEV) protease recognition and
                     cleavage site"
                     /label=TEV site
                     /translation="ENLYFQG"
     misc_feature    2007..2014
                     /label=PmeI recognition site
                     /note="PmeI recognition site"
     misc_feature    2015..2681
                     /label=LIC stuffer fragment
                     /note="LIC stuffer fragment"
     misc_feature    2682..2689
                     /label=PmeI recognition site
                     /note="PmeI recognition site"
     CDS             2709..2726
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     regulatory      2730..3071
                     /regulatory_class="terminator"
                     /note="terminator"
     terminator      2806..3052
                     /gene="Pichia pastoris AOX1"
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     promoter        3067..3478
                     /gene="S. cerevisiae TEF1"
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        3486..3533
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter "
     CDS             3552..3926
                     /codon_start=1
                     /product="zeocin resistance marker"
                     /label=zeocin resistance marker
                     /protein_id="AEE81076.1"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      3992..4239
                     /gene="S. cerevisiae CYC1"
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      4255..4928
                     /label=pBR322 origin
                     /note="pBR322 origin"
     rep_origin      complement(4314..4902)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.