Basic Vector Information
LIC-pDEST-LC1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
LIC-pDEST-LC1 vector Sequence
LOCUS 40924_1749 6366 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector LIC-pDEST-LC1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6366) AUTHORS Dortay H, Akula UM, Westphal C, Sittig M, Mueller-Roeber B. TITLE High-Throughput Protein Expression Using a Combination of Ligation-Independent Cloning (LIC) and Infrared Fluorescent Protein (IFP) Detection JOURNAL PLoS ONE 6 (4), E18900 (2011) PUBMED 21541323 REFERENCE 2 (bases 1 to 6366) AUTHORS Dortay H, Mueller-Roeber B. TITLE Direct Submission JOURNAL Submitted (12-FEB-2011) Molecular Biology, University of Potsdam, Germany, Karl-Liebknecht-Str. 24-25, Haus 20, Potsdam, Brandenburg 14476, Germany REFERENCE 3 (bases 1 to 6366) TITLE Direct Submission REFERENCE 4 (bases 1 to 6366) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2011"; volume: "6"; issue: "4"; pages: "E18900" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-FEB-2011) Molecular Biology, University of Potsdam, Germany, Karl-Liebknecht-Str. 24-25, Haus 20, Potsdam, Brandenburg 14476, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6366 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 10..27 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 37..1020 /codon_start=1 /label=IFP1.4 /note="bacteriophytochrome-based monomeric infrared fluorescent protein (Shu et al., 2009)" /translation="MARDPLPFFPPLYLGGPEITTENCEREPIHIPGSIQPHGALLTAD GHSGEVLQVSLNAATFLGQEPTVLRGQTLAALLPEQWPALQAALPPGCPDALQYRATLD WPAAGHLSLTVHRVAELLILEFEPTEAWDSIGPHALRNAMFALESAPNLRALAEVATQT VRELTGFDRVMLYKFAPDATGEMIAEARREGMQAFLGHRFPASHTPAQARALYTRHLLR LTADTRAAAVPLDPVLNPQTNAPTPLGGAVLRATSPMHMQYLRNMGVGSSLSVSVVVGG QLWGLIVCHHQTPYVLPPDLRTTLEELGRKLSGQVQRKEAGMDELYK" CDS 1021..1041 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" misc_feature 1060..1067 /label=PmeI recognition site /note="PmeI recognition site" misc_feature 1068..1734 /label=LIC stuffer fragment /note="LIC stuffer fragment" misc_feature 1735..1742 /label=PmeI recognition site /note="PmeI recognition site" terminator 1820..1867 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" promoter complement(2233..2261) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" promoter 2374..2478 /label=AmpR promoter CDS 2479..3336 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 3510..4098 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4284..4426) /label=bom /note="basis of mobility region from pBR322" CDS complement(4531..4719) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" promoter 6284..6302 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" RBS 6334..6356 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" misc_feature 6364..6366 /label=start codon /note="start codon"
This page is informational only.