This page is informational only.
Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | L189-1 | Antibiotic Resistance | Kanamycin |
Length | 5818 bp | Type | Expression vector |
Source | Sommer F, Awazu S, Anton-Erxleben F, Jiang D, Klimovich AV, Klimovich BV, Samoilovich MP, Satou Y, Kruss M, Gelhaus C, Kurn U, Bosch TC, Khalturin K. |
L189-1 vector Vector Map
L189-1 vector Sequence
LOCUS Exported 5818 bp ds-DNA circular SYN 17-DEC-2018 DEFINITION Expression vector L189-1, complete sequence. ACCESSION JF419126 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5818) AUTHORS Sommer F, Awazu S, Anton-Erxleben F, Jiang D, Klimovich AV, Klimovich BV, Samoilovich MP, Satou Y, Kruss M, Gelhaus C, Kurn U, Bosch TC, Khalturin K. TITLE Blood System Formation in the Urochordate Ciona intestinalis Requires the Variable Receptor vCRL1 JOURNAL Mol. Biol. Evol. 29 (10), 3081-3093 (2012) PUBMED 22513285 REFERENCE 2 (bases 1 to 5818) AUTHORS Sommer F, Awazu S, Anton-Erxleben F, Jiang D, Klimovich AV, Klimovich VB, Samoilovich MP, Satou Y, Kruess M, Gelhaus C, Kuern U, Bosch TCG., Khalturin K. TITLE Direct Submission JOURNAL Submitted (16-FEB-2011) Zoological Institute, Christian-Albrechts University Kiel, Am Botanischen Garten 9, Kiel, Schleswig-Holstein 24118, Germany REFERENCE 3 (bases 1 to 5818) AUTHORS . TITLE Direct Submission JOURNAL Exported Dec 18, 2018 from SnapGene 4.1.8 http://www.snapgene.com FEATURES Location/Qualifiers source 1..5818 /organism="Expression vector L189-1" /mol_type="other DNA" /label=pET28a_vCRL1_1-o(L189-1) /note="pET28a_vCRL1_1-o(L189-1)" /db_xref="taxon:997205" rep_origin 12..467 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(560..1375) /codon_start=1 /gene="aph(3')-Ia" /product="aminoglycoside phosphotransferase" /label=KanR /note="confers resistance to kanamycin in bacteria or G418 (Geneticin(R)) in eukaryotes" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1497..2085 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2271..2413 /label=bom /note="basis of mobility region from pBR322" CDS complement(2515..2706) /codon_start=1 /gene="rop" /product="Rop protein, which maintains plasmids at low copy number" /label=rop /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" CDS complement(3515..4597) /codon_start=1 /gene="lacI" /product="lac repressor" /label=lacI /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4598..4675) /gene="lacI" /label=lacI promoter promoter 4984..5002 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5003..5027 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5042..5064 /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 5083..5100 /codon_start=1 /product="6xHis affinity tag" /label=6xHis /translation="HHHHHH" CDS 5110..5127 /codon_start=1 /product="thrombin recognition and cleavage site" /label=thrombin site /translation="LVPRGS" CDS 5662..5679 /codon_start=1 /product="6xHis affinity tag" /label=6xHis /translation="HHHHHH" terminator 5746..5793 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"